Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01492
Gene name
Locationscaffold_01:5149822..5150322
Strand+
Gene length (bp)500
Transcript length (bp)441
Coding sequence length (bp)441
Protein length (aa) 147

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04110 APG12 Ubiquitin-like autophagy protein Apg12 2.9E-25 59 146

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0000045 autophagosome assembly Yes
GO:0005575 cellular_component No
GO:0071840 cellular component organization or biogenesis No
GO:1905037 autophagosome organization No
GO:0008150 biological_process No
GO:0007033 vacuole organization No
GO:0006996 organelle organization No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0070925 organelle assembly No
GO:0016043 cellular component organization No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6592 0.4076 0.1531 0.0724 0.1808 0.0075 0.1355 0.4265 0.2758 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5333
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5657
Ophiocordyceps australis map64 (Brazil) OphauB2|1310
Ophiocordyceps camponoti-floridani Ophcf2|01492 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3426
Ophiocordyceps kimflemingae Ophio5|3558
Ophiocordyceps subramaniannii Hirsu2|5051

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01492
MASEAAPSKAGAVPDSADDQAVTSSPELPLTMSASVMLADLPRDATWALADAGAFAQEKVVVRFKPVGAAPGLAQ
DLCKISAARRFEEVVRYLRRKLRCAETESVFLYVNSAFAPSLDEVVGNLHRCFKNAQDQLVVAYSITPAFG*
Coding >Ophcf2|01492
ATGGCCTCAGAAGCGGCCCCCTCGAAAGCAGGCGCAGTCCCAGACTCAGCCGACGACCAAGCCGTAACCTCATCT
CCCGAGCTGCCCCTGACCATGTCGGCGTCGGTGATGCTGGCCGACCTCCCGCGCGACGCGACTTGGGCGCTGGCA
GACGCGGGTGCCTTTGCGCAGGAAAAGGTGGTGGTGCGGTTCAAGCCTGTGGGTGCGGCGCCGGGGCTGGCGCAG
GACCTTTGCAAGATTTCGGCGGCGAGGCGGTTTGAGGAGGTGGTGCGGTATCTGAGGAGGAAGTTGAGGTGTGCT
GAGACGGAGAGCGTCTTTCTCTACGTGAATAGTGCCTTTGCGCCGTCGCTGGATGAGGTGGTTGGCAACTTGCAT
CGGTGCTTCAAGAATGCTCAAGATCAACTCGTTGTTGCCTATTCTATCACGCCTGCCTTTGGCTAG
Transcript >Ophcf2|01492
ATGGCCTCAGAAGCGGCCCCCTCGAAAGCAGGCGCAGTCCCAGACTCAGCCGACGACCAAGCCGTAACCTCATCT
CCCGAGCTGCCCCTGACCATGTCGGCGTCGGTGATGCTGGCCGACCTCCCGCGCGACGCGACTTGGGCGCTGGCA
GACGCGGGTGCCTTTGCGCAGGAAAAGGTGGTGGTGCGGTTCAAGCCTGTGGGTGCGGCGCCGGGGCTGGCGCAG
GACCTTTGCAAGATTTCGGCGGCGAGGCGGTTTGAGGAGGTGGTGCGGTATCTGAGGAGGAAGTTGAGGTGTGCT
GAGACGGAGAGCGTCTTTCTCTACGTGAATAGTGCCTTTGCGCCGTCGCTGGATGAGGTGGTTGGCAACTTGCAT
CGGTGCTTCAAGAATGCTCAAGATCAACTCGTTGTTGCCTATTCTATCACGCCTGCCTTTGGCTAG
Gene >Ophcf2|01492
ATGGCCTCAGAAGCGGCCCCCTCGAAAGCAGGCGCAGTCCCAGACTCAGCCGACGACCAAGCCGTAACCTCATCT
CCCGAGCTGCCCCTGACCATGTCGGCGTCGGTGATGCTGGCCGACCTCCCGCGCGACGCGACTTGGGCGCTGGCA
GACGCGGGTGCCTTTGCGCAGGAAAAGGTGGTGGTGCGGTTCAAGCCTGTGGGTGCGGCGCCGGGGCTGGCGCAG
GACCTTTGCAAGATTTCGGCGGCGAGGCGGTTTGAGGAGGTGGTGCGGTATCTGAGGAGGAAGTTGAGGTGTGCT
GAGACGGAGAGCGTCTTTCTCTACGTGAATAGTGCCTTTGCGCCGTCGCTGGATGAGGTGGTTGGCAACTTGCAT
CGGGTATTTGTCTCTGGATCTTTTGCCTTCTTGGATGGTGATTGCTGATGATTCTGGTATAGTGCTTCAAGAATG
CTCAAGATCAACTCGTTGTTGCCTATTCTATCACGCCTGCCTTTGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail