Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01491
Gene name
Locationscaffold_01:5146103..5148678
Strand+
Gene length (bp)2575
Transcript length (bp)2160
Coding sequence length (bp)2160
Protein length (aa) 720

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08630 Dfp1_Him1_M Dfp1/Him1, central region 4.4E-41 285 416
PF07535 zf-DBF DBF zinc finger 1.5E-21 657 700

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0003676 nucleic acid binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2295 0.897 0.1167 0.0278 0.1245 0.0028 0.0244 0.0119 0.0203 0.0012

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1458
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5228
Ophiocordyceps australis map64 (Brazil) OphauB2|1314
Ophiocordyceps camponoti-floridani Ophcf2|01491 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3425
Ophiocordyceps kimflemingae Ophio5|3555
Ophiocordyceps subramaniannii Hirsu2|11026

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01491
MFSPKTPPAREPRNRRRVALPARRVLQATLCRALMAAVSLSPTPAHVTVMSSRRAPLANNPNVINSPLRGTSALS
CYAKPKRSHGSAQRDEPYLQQPALKKQALENGGQRLIRSPNKPRPQVLVQRTSIPSARSVTAANKDRVSRALHDN
ETEAWKKHYRAKFPKMVFYFESIPDDVRAKLTKRVTYFGARQEPFFSIDVTHVITTRTIPQERAEAATQETAAST
ENDQQRKQQSEEQPQTINPSLLDRTTAARRKLLFEFRQAPSSSQQLKRTGSGNGKPRNNDVLHKAREMGKKIWSL
DKFQTMLSVLLDSEAHAPGASRNPSPRNPYGAAKGPHEPDLLQLLHNERINGPSDRDPTAVNRELIYFKGPYIYV
WDMDEKQKPIMARDYPKVANKTDGEWPQFRSVANGRCPFVEDVELIPEKKDCHKGRDRDRARAAAAVTVAKRDDD
AAPVLIPKPPKTIPLAKPVTGKRRLSEVEAAGRNKTTTRTATAAGPTDSLTPAASKEGETSRTMQNAFVSRAAAC
PGRLLAGEPVASGLQASNVTSAIRSQMISSASGIQGAKAGISKEMHGLQRKVLQKTTTSQDPSSRRLAEKSLDVA
SSRSMSRQTSRTVHAPDDDGHSHRAAAAATPTTAAVVDSKESKPRPQQALKSKRDLKPGYCENCQEKFPDFDEHI
ASRKHRKFAENNDNWTELDSLLAQLKRIPKYQSGSESDSDGAAW*
Coding >Ophcf2|01491
ATGTTTTCGCCCAAAACACCGCCTGCCCGTGAGCCCCGCAATCGTCGACGTGTTGCCCTCCCTGCACGTCGCGTC
CTGCAGGCCACGCTCTGCCGGGCATTGATGGCAGCCGTATCTCTATCGCCCACGCCAGCTCACGTCACGGTCATG
TCCTCGCGGCGGGCACCCCTTGCCAACAATCCCAATGTCATCAACTCGCCCCTGCGAGGGACCTCGGCCCTGTCC
TGCTATGCCAAGCCGAAACGCTCTCACGGCTCTGCTCAGCGCGACGAGCCGTACCTTCAGCAGCCTGCCTTGAAG
AAGCAGGCCCTGGAAAATGGTGGCCAGCGTCTCATCCGGTCTCCAAACAAACCCCGGCCCCAGGTTCTGGTTCAG
CGAACCTCGATCCCTTCTGCTCGCTCTGTCACCGCCGCCAACAAGGATCGTGTTTCGAGAGCCTTGCACGATAAC
GAAACGGAGGCATGGAAGAAACACTATAGGGCTAAGTTTCCTAAGATGGTCTTCTACTTCGAGAGCATCCCCGAT
GACGTCCGGGCCAAATTAACCAAGAGGGTCACCTACTTTGGAGCTCGTCAAGAACCCTTCTTCTCCATCGACGTC
ACGCACGTCATCACCACTCGCACCATTCCTCAAGAGCGAGCGGAAGCTGCCACGCAGGAGACGGCTGCCTCTACC
GAAAATGACCAGCAGCGGAAACAGCAGTCAGAGGAACAGCCTCAGACTATTAACCCATCTCTGCTCGATAGAACA
ACAGCTGCGAGACGCAAGTTGCTGTTCGAGTTTCGCCAAGCTCCCAGCTCCTCGCAGCAGCTCAAACGGACCGGC
AGCGGCAACGGTAAACCCAGAAACAACGATGTTCTTCACAAGGCCCGCGAGATGGGAAAGAAGATTTGGTCGCTC
GACAAGTTCCAAACGATGCTCTCGGTCCTGCTGGACTCCGAGGCTCACGCTCCCGGCGCTTCTCGAAATCCGAGC
CCGCGCAACCCTTACGGTGCAGCCAAGGGTCCGCACGAGCCAGATCTGCTTCAGCTGCTTCACAACGAGCGCATC
AACGGGCCTTCTGATCGCGATCCCACGGCCGTCAACAGGGAGCTCATCTACTTCAAGGGCCCCTACATCTACGTC
TGGGACATGGACGAGAAGCAGAAGCCCATCATGGCCCGCGACTATCCAAAAGTAGCCAACAAGACGGACGGCGAA
TGGCCTCAGTTCCGCAGCGTCGCCAACGGACGCTGCCCCTTTGTGGAAGACGTCGAGCTCATACCGGAGAAGAAG
GACTGTCACAAGGGCCGCGATCGAGACAGGGCTCGTGCGGCCGCAGCCGTCACCGTGGCCAAGCGAGACGACGAT
GCCGCGCCGGTCCTGATTCCGAAGCCGCCCAAGACGATTCCCTTGGCTAAGCCGGTGACGGGGAAGCGGCGCTTG
AGCGAGGTAGAGGCCGCTGGCCGCAATAAGACGACGACGCGCACTGCCACGGCTGCAGGCCCGACAGACTCGCTC
ACCCCTGCCGCTTCCAAGGAAGGGGAGACATCCAGGACGATGCAGAATGCCTTCGTCAGCCGCGCCGCAGCCTGT
CCCGGCCGCCTCCTCGCGGGGGAGCCCGTAGCCTCGGGCCTGCAGGCTTCCAACGTGACGTCGGCCATCCGCTCG
CAGATGATCTCGTCTGCCTCGGGAATACAAGGAGCCAAGGCGGGAATCAGCAAGGAGATGCACGGCCTGCAGCGC
AAGGTACTGCAGAAGACGACGACTTCGCAGGACCCGAGTTCGCGTCGACTGGCGGAAAAGTCGTTGGACGTCGCA
TCTAGCAGATCGATGAGCCGGCAGACGTCACGGACCGTGCACGCCCCCGACGATGACGGCCACTCGCACCGCGCG
GCGGCTGCGGCAACTCCTACGACGGCAGCGGTCGTGGACAGCAAAGAATCCAAGCCGAGGCCGCAGCAGGCGCTC
AAGAGCAAGAGGGATCTGAAGCCCGGTTACTGCGAGAACTGCCAGGAGAAGTTTCCCGACTTTGACGAGCACATT
GCATCCCGAAAGCACCGCAAGTTTGCCGAAAACAACGACAACTGGACCGAGCTCGACAGCCTCCTCGCCCAGCTG
AAGCGTATCCCCAAGTACCAGTCCGGCTCAGAATCGGACTCTGATGGAGCCGCCTGGTGA
Transcript >Ophcf2|01491
ATGTTTTCGCCCAAAACACCGCCTGCCCGTGAGCCCCGCAATCGTCGACGTGTTGCCCTCCCTGCACGTCGCGTC
CTGCAGGCCACGCTCTGCCGGGCATTGATGGCAGCCGTATCTCTATCGCCCACGCCAGCTCACGTCACGGTCATG
TCCTCGCGGCGGGCACCCCTTGCCAACAATCCCAATGTCATCAACTCGCCCCTGCGAGGGACCTCGGCCCTGTCC
TGCTATGCCAAGCCGAAACGCTCTCACGGCTCTGCTCAGCGCGACGAGCCGTACCTTCAGCAGCCTGCCTTGAAG
AAGCAGGCCCTGGAAAATGGTGGCCAGCGTCTCATCCGGTCTCCAAACAAACCCCGGCCCCAGGTTCTGGTTCAG
CGAACCTCGATCCCTTCTGCTCGCTCTGTCACCGCCGCCAACAAGGATCGTGTTTCGAGAGCCTTGCACGATAAC
GAAACGGAGGCATGGAAGAAACACTATAGGGCTAAGTTTCCTAAGATGGTCTTCTACTTCGAGAGCATCCCCGAT
GACGTCCGGGCCAAATTAACCAAGAGGGTCACCTACTTTGGAGCTCGTCAAGAACCCTTCTTCTCCATCGACGTC
ACGCACGTCATCACCACTCGCACCATTCCTCAAGAGCGAGCGGAAGCTGCCACGCAGGAGACGGCTGCCTCTACC
GAAAATGACCAGCAGCGGAAACAGCAGTCAGAGGAACAGCCTCAGACTATTAACCCATCTCTGCTCGATAGAACA
ACAGCTGCGAGACGCAAGTTGCTGTTCGAGTTTCGCCAAGCTCCCAGCTCCTCGCAGCAGCTCAAACGGACCGGC
AGCGGCAACGGTAAACCCAGAAACAACGATGTTCTTCACAAGGCCCGCGAGATGGGAAAGAAGATTTGGTCGCTC
GACAAGTTCCAAACGATGCTCTCGGTCCTGCTGGACTCCGAGGCTCACGCTCCCGGCGCTTCTCGAAATCCGAGC
CCGCGCAACCCTTACGGTGCAGCCAAGGGTCCGCACGAGCCAGATCTGCTTCAGCTGCTTCACAACGAGCGCATC
AACGGGCCTTCTGATCGCGATCCCACGGCCGTCAACAGGGAGCTCATCTACTTCAAGGGCCCCTACATCTACGTC
TGGGACATGGACGAGAAGCAGAAGCCCATCATGGCCCGCGACTATCCAAAAGTAGCCAACAAGACGGACGGCGAA
TGGCCTCAGTTCCGCAGCGTCGCCAACGGACGCTGCCCCTTTGTGGAAGACGTCGAGCTCATACCGGAGAAGAAG
GACTGTCACAAGGGCCGCGATCGAGACAGGGCTCGTGCGGCCGCAGCCGTCACCGTGGCCAAGCGAGACGACGAT
GCCGCGCCGGTCCTGATTCCGAAGCCGCCCAAGACGATTCCCTTGGCTAAGCCGGTGACGGGGAAGCGGCGCTTG
AGCGAGGTAGAGGCCGCTGGCCGCAATAAGACGACGACGCGCACTGCCACGGCTGCAGGCCCGACAGACTCGCTC
ACCCCTGCCGCTTCCAAGGAAGGGGAGACATCCAGGACGATGCAGAATGCCTTCGTCAGCCGCGCCGCAGCCTGT
CCCGGCCGCCTCCTCGCGGGGGAGCCCGTAGCCTCGGGCCTGCAGGCTTCCAACGTGACGTCGGCCATCCGCTCG
CAGATGATCTCGTCTGCCTCGGGAATACAAGGAGCCAAGGCGGGAATCAGCAAGGAGATGCACGGCCTGCAGCGC
AAGGTACTGCAGAAGACGACGACTTCGCAGGACCCGAGTTCGCGTCGACTGGCGGAAAAGTCGTTGGACGTCGCA
TCTAGCAGATCGATGAGCCGGCAGACGTCACGGACCGTGCACGCCCCCGACGATGACGGCCACTCGCACCGCGCG
GCGGCTGCGGCAACTCCTACGACGGCAGCGGTCGTGGACAGCAAAGAATCCAAGCCGAGGCCGCAGCAGGCGCTC
AAGAGCAAGAGGGATCTGAAGCCCGGTTACTGCGAGAACTGCCAGGAGAAGTTTCCCGACTTTGACGAGCACATT
GCATCCCGAAAGCACCGCAAGTTTGCCGAAAACAACGACAACTGGACCGAGCTCGACAGCCTCCTCGCCCAGCTG
AAGCGTATCCCCAAGTACCAGTCCGGCTCAGAATCGGACTCTGATGGAGCCGCCTGGTGA
Gene >Ophcf2|01491
ATGTTTTCGCCCAAAACAGTATAGCGCTGTTTTGCCAAGCGCGAAGGCCTTTCTCCTAACAAGCTGCTTTGGCTT
CAACAAAACAGCGTGCGAATACATACGCCTGGGTTTGCACGTCGTCACTAAAGTGCTCCCGAAGACGGCCTCTGC
TTCTTTCACCCTCCCTCCCTCTCTCCCGCTCGTCTCTTCTCTCTTCTCTCTTTCTCTCTCGCCGCCTTCAATGCC
TGAGGCAACATCCTTAGCCGCCTGCCCGTGAGCCCCGCAATCGTCGACGTGTTGCCCTCCCTGCACGTCGCGTCC
TGCAGGCCACGCTCTGCCGGTCGGTTCGGTGACCCTCTTGGCCAGCTGCTTTTCCTCTCCGCCGCTGACGGTCTT
CCCAGGGCATTGATGGCAGCCGTATCTCTATCGCCCACGCCAGCTCACGTCACGGTCATGTCCTCGCGGCGGGCA
CCCCTTGCCAACAATCCCAATGTCATCAACTCGCCCCTGCGAGGGACCTCGGCCCTGTCCTGCTATGCCAAGCCG
AAACGCTCTCACGGCTCTGCTCAGCGCGACGAGCCGTACCTTCAGCAGCCTGCCTTGAAGAAGCAGGCCCTGGAA
AATGGTGGCCAGCGTCTCATCCGGTCTCCAAACAAACCCCGGCCCCAGGTTCTGGTTCAGCGAACCTCGATCCCT
TCTGCTCGCTCTGTCACCGCCGCCAACAAGGATCGTGTTTCGAGAGCCTTGCACGATAACGAAACGGAGGCATGG
AAGAAACACTATAGGGCTAAGTTTCCTAAGATGGTCTTCTACTTCGAGAGCATCCCCGATGACGTCCGGGCCAAA
TTAACCAAGAGGGTCACCTACTTTGGAGCTGTACGTTCACGTCATTTTGTTTTCCCTACTACTCACCTTCTGCAC
GACCGCTAATGTTTTCTTTCCTCACAGCGTCAAGAACCCTTCTTCTCCATCGACGTCACGCACGTCATCACCACT
CGCACCATTCCTCAAGAGCGAGCGGAAGCTGCCACGCAGGAGACGGCTGCCTCTACCGAAAATGACCAGCAGCGG
AAACAGCAGTCAGAGGAACAGCCTCAGACTATTAACCCATCTCTGCTCGATAGAACAACAGCTGCGAGACGCAAG
TTGCTGTTCGAGTTTCGCCAAGCTCCCAGCTCCTCGCAGCAGCTCAAACGGACCGGCAGCGGCAACGGTAAACCC
AGAAACAACGATGTTCTTCACAAGGCCCGCGAGATGGGAAAGAAGATTTGGTCGCTCGACAAGTTCCAAACGATG
CTCTCGGTCCTGCTGGACTCCGAGGCTCACGCTCCCGGCGCTTCTCGAAATCCGAGCCCGCGCAACCCTTACGGT
GCAGCCAAGGGTCCGCACGAGCCAGATCTGCTTCAGCTGCTTCACAACGAGCGCATCAACGGGCCTTCTGATCGC
GATCCCACGGCCGTCAACAGGGAGCTCATCTACTTCAAGGGCCCCTACATCTACGTCTGGGACATGGACGAGAAG
CAGAAGCCCATCATGGCCCGCGACTATCCAAAAGTAGCCAACAAGACGGACGGCGAATGGCCTCAGTTCCGCAGC
GTCGCCAACGGACGCTGCCCCTTTGTGGAAGACGTCGAGCTCATACCGGAGAAGAAGGACTGTCACAAGGGCCGC
GATCGAGACAGGGCTCGTGCGGCCGCAGCCGTCACCGTGGCCAAGCGAGACGACGATGCCGCGCCGGTCCTGATT
CCGAAGCCGCCCAAGACGATTCCCTTGGCTAAGCCGGTGACGGGGAAGCGGCGCTTGAGCGAGGTAGAGGCCGCT
GGCCGCAATAAGACGACGACGCGCACTGCCACGGCTGCAGGCCCGACAGACTCGCTCACCCCTGCCGCTTCCAAG
GAAGGGGAGACATCCAGGACGATGCAGAATGCCTTCGTCAGCCGCGCCGCAGCCTGTCCCGGCCGCCTCCTCGCG
GGGGAGCCCGTAGCCTCGGGCCTGCAGGCTTCCAACGTGACGTCGGCCATCCGCTCGCAGATGATCTCGTCTGCC
TCGGGAATACAAGGAGCCAAGGCGGGAATCAGCAAGGAGATGCACGGCCTGCAGCGCAAGGTACTGCAGAAGACG
ACGACTTCGCAGGACCCGAGTTCGCGTCGACTGGCGGAAAAGTCGTTGGACGTCGCATCTAGCAGATCGATGAGC
CGGCAGACGTCACGGACCGTGCACGCCCCCGACGATGACGGCCACTCGCACCGCGCGGCGGCTGCGGCAACTCCT
ACGACGGCAGCGGTCGTGGACAGCAAAGAATCCAAGCCGAGGCCGCAGCAGGCGCTCAAGAGCAAGAGGGATCTG
AAGCCCGGTTACTGCGAGAACTGCCAGGAGAAGTTTCCCGACTTTGACGAGGTTGATTTTTCCTTCATTATATAT
AATCTTTGGTCTACGGCTGCTGACAGGACACAAGCACATTGCATCCCGAAAGCACCGCAAGTTTGCCGAAAACAA
CGACAACTGGACCGAGCTCGACAGCCTCCTCGCCCAGCTGAAGCGTATCCCCAAGTACCAGTCCGGCTCAGAATC
GGACTCTGATGGAGCCGCCTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail