Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01490
Gene name
Locationscaffold_01:5144440..5145950
Strand-
Gene length (bp)1510
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 1.6E-50 232 450
PF05195 AMP_N Aminopeptidase P, N-terminal domain 3.8E-35 68 190

GO

GO Term Description Terminal node
GO:0070006 metalloaminopeptidase activity Yes
GO:0030145 manganese ion binding Yes
GO:0043169 cation binding No
GO:0004177 aminopeptidase activity No
GO:0046914 transition metal ion binding No
GO:0008237 metallopeptidase activity No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0043167 ion binding No
GO:0016787 hydrolase activity No
GO:0008235 metalloexopeptidase activity No
GO:0008238 exopeptidase activity No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1432 0.1207 0.0434 0.0833 0.9034 0.1136 0.0363 0.0652 0.1062 0.0164

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1457
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5229
Ophiocordyceps australis map64 (Brazil) OphauB2|1315
Ophiocordyceps camponoti-floridani Ophcf2|01490 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3424
Ophiocordyceps kimflemingae Ophio5|3554
Ophiocordyceps subramaniannii Hirsu2|11025

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01490
MSRRLLLSALGRRDRLSSRWGGGRAAVVSKRSLETSAFDLRFGQPVHETHPHVLKAGELTPGISAHEYADRRAAL
AHALDPGGVAVLPSANLRYKSGAVFYPFRQETNLFWLTGWDEPEAVAVIEKTGPRLGDYLFRLFVRPKDAFQELW
NGYRNGVDAATDFFNADEAHDISAVKSTLPDILASSEHVYADRINSGGMDMHDLLTPVVSKTKPLSPLVEDFRVI
KSPAEVENMRRAGRASGRAFTNAMRTAWDSERHVHAFLDYQFVTNGCDGTAYVPVVAGGDRANCIHYTANNDVFR
DGELILVDAGGECGSYVTDISRTWPVNGRFSPAQRDLYEAVLRVQRHGVGLCRESANTSLNEIHKITEQKLEAEL
RDLGFDKSRMSQLFPHHVGHYVGLDVHDCSSVSRSEKLRKGHCLTIEPGVYVPDEAGWPKHFRGTGIRIEDSVCV
DRDSPLILTTEAVKEIADIEALRSQ*
Coding >Ophcf2|01490
ATGAGCCGCAGATTGCTGCTCTCCGCTTTGGGGAGACGGGACCGGCTGTCCAGCAGATGGGGCGGCGGGAGAGCA
GCAGTCGTCAGCAAAAGGAGCCTGGAAACCTCCGCCTTCGACCTCAGGTTCGGTCAGCCCGTTCACGAGACGCAC
CCCCACGTCCTCAAGGCCGGCGAGCTCACGCCGGGCATCTCCGCTCACGAATATGCCGACCGCCGAGCCGCTCTC
GCCCACGCGTTGGATCCCGGCGGCGTCGCCGTCTTGCCCAGTGCCAACCTGCGCTACAAGTCCGGCGCCGTCTTC
TATCCCTTTCGTCAGGAGACAAACTTGTTTTGGCTGACGGGCTGGGACGAGCCTGAAGCCGTTGCCGTCATAGAA
AAGACGGGTCCGCGACTGGGGGATTACCTCTTTCGCCTCTTCGTCCGGCCCAAAGACGCTTTTCAGGAGTTATGG
AACGGCTATCGCAACGGTGTCGATGCTGCCACTGATTTCTTCAATGCCGACGAGGCGCACGACATCAGCGCAGTC
AAATCCACTCTTCCTGACATCCTCGCATCGTCTGAGCATGTCTACGCCGACAGAATCAATAGCGGTGGCATGGAC
ATGCACGACCTCCTCACTCCCGTCGTCTCCAAGACGAAACCTCTGTCGCCACTCGTAGAGGACTTCCGCGTCATA
AAGAGCCCAGCCGAGGTGGAGAACATGAGAAGAGCCGGGCGCGCGTCCGGCCGGGCCTTCACAAACGCCATGCGC
ACAGCTTGGGACAGCGAGAGACATGTACACGCCTTCCTCGACTATCAGTTCGTCACCAACGGCTGCGACGGTACC
GCATACGTGCCTGTCGTCGCTGGCGGCGATCGAGCCAACTGCATCCACTACACCGCCAACAACGACGTCTTCCGA
GACGGCGAACTGATTCTCGTCGACGCCGGCGGCGAGTGCGGCTCATACGTGACGGACATTTCCCGCACCTGGCCC
GTCAACGGCCGCTTCTCCCCCGCCCAGCGAGACCTTTACGAAGCCGTCCTCCGCGTCCAGCGCCACGGCGTCGGA
CTCTGCCGCGAATCAGCCAACACGTCGCTCAACGAAATCCACAAAATCACGGAGCAGAAACTAGAAGCCGAGCTG
CGGGACCTCGGCTTCGACAAGAGCAGGATGAGCCAGCTCTTCCCCCACCACGTCGGCCACTACGTCGGCCTCGAC
GTCCACGACTGTTCCAGCGTCAGCCGCTCGGAGAAGCTGCGCAAGGGTCACTGCCTCACCATCGAACCGGGCGTC
TACGTGCCTGACGAAGCCGGCTGGCCCAAACACTTCCGCGGGACGGGTATCCGTATCGAGGACAGCGTCTGCGTC
GACCGAGATTCGCCGCTCATCCTAACGACCGAGGCCGTCAAGGAGATAGCCGACATCGAGGCCCTTCGGTCTCAA
TGA
Transcript >Ophcf2|01490
ATGAGCCGCAGATTGCTGCTCTCCGCTTTGGGGAGACGGGACCGGCTGTCCAGCAGATGGGGCGGCGGGAGAGCA
GCAGTCGTCAGCAAAAGGAGCCTGGAAACCTCCGCCTTCGACCTCAGGTTCGGTCAGCCCGTTCACGAGACGCAC
CCCCACGTCCTCAAGGCCGGCGAGCTCACGCCGGGCATCTCCGCTCACGAATATGCCGACCGCCGAGCCGCTCTC
GCCCACGCGTTGGATCCCGGCGGCGTCGCCGTCTTGCCCAGTGCCAACCTGCGCTACAAGTCCGGCGCCGTCTTC
TATCCCTTTCGTCAGGAGACAAACTTGTTTTGGCTGACGGGCTGGGACGAGCCTGAAGCCGTTGCCGTCATAGAA
AAGACGGGTCCGCGACTGGGGGATTACCTCTTTCGCCTCTTCGTCCGGCCCAAAGACGCTTTTCAGGAGTTATGG
AACGGCTATCGCAACGGTGTCGATGCTGCCACTGATTTCTTCAATGCCGACGAGGCGCACGACATCAGCGCAGTC
AAATCCACTCTTCCTGACATCCTCGCATCGTCTGAGCATGTCTACGCCGACAGAATCAATAGCGGTGGCATGGAC
ATGCACGACCTCCTCACTCCCGTCGTCTCCAAGACGAAACCTCTGTCGCCACTCGTAGAGGACTTCCGCGTCATA
AAGAGCCCAGCCGAGGTGGAGAACATGAGAAGAGCCGGGCGCGCGTCCGGCCGGGCCTTCACAAACGCCATGCGC
ACAGCTTGGGACAGCGAGAGACATGTACACGCCTTCCTCGACTATCAGTTCGTCACCAACGGCTGCGACGGTACC
GCATACGTGCCTGTCGTCGCTGGCGGCGATCGAGCCAACTGCATCCACTACACCGCCAACAACGACGTCTTCCGA
GACGGCGAACTGATTCTCGTCGACGCCGGCGGCGAGTGCGGCTCATACGTGACGGACATTTCCCGCACCTGGCCC
GTCAACGGCCGCTTCTCCCCCGCCCAGCGAGACCTTTACGAAGCCGTCCTCCGCGTCCAGCGCCACGGCGTCGGA
CTCTGCCGCGAATCAGCCAACACGTCGCTCAACGAAATCCACAAAATCACGGAGCAGAAACTAGAAGCCGAGCTG
CGGGACCTCGGCTTCGACAAGAGCAGGATGAGCCAGCTCTTCCCCCACCACGTCGGCCACTACGTCGGCCTCGAC
GTCCACGACTGTTCCAGCGTCAGCCGCTCGGAGAAGCTGCGCAAGGGTCACTGCCTCACCATCGAACCGGGCGTC
TACGTGCCTGACGAAGCCGGCTGGCCCAAACACTTCCGCGGGACGGGTATCCGTATCGAGGACAGCGTCTGCGTC
GACCGAGATTCGCCGCTCATCCTAACGACCGAGGCCGTCAAGGAGATAGCCGACATCGAGGCCCTTCGGTCTCAA
TGA
Gene >Ophcf2|01490
ATGAGCCGCAGATTGCTGCTCTCCGCTTTGGGGAGACGGGACCGGCTGTCCAGCAGATGGGGCGGCGGGAGAGCA
GCAGTCGTCAGCAAAAGGAGCCTGGAAACCTCCGCCTTCGACCTCAGGTTCGGTCAGCCCGTTCACGAGACGCAC
CCCCACGTCCTCAAGGCCGGCGAGCGCAAGTGCCCCCAGCAAATCGCACAGCAGCCTGCTACAGGCTACCGCTAC
CTCTAGTCGTGACTCTGACGCCCCCAGCGCAGTCACGCCGGGCATCTCCGCTCACGAATATGCCGACCGCCGAGC
CGCTCTCGCCCACGCGTTGGATCCCGGCGGCGTCGCCGTCTTGCCCAGTGCCAACCTGCGCTACAAGTCCGGCGC
CGTCTTCTATCCCTTTCGTCAGGAGACAAACTTGTTTTGGCTGACGGGCTGGGACGAGCCTGAAGCCGTTGCCGT
CATAGAAAAGACGGGTCCGCGACTGGGGGATTACCTCTTTCGCCTCTTCGTCCGGCCCAAAGACGCTTTTCAGGA
GTTATGGAACGGCTATCGCAACGGTGTCGATGCTGCCACTGATTTCTTCAATGCCGACGAGGCGCACGACATCAG
CGCAGTCAAATCCACTCTTCCTGACATCCTCGCATCGTCTGAGCATGTCTACGCCGACAGAATCAATAGCGGTGG
CATGGACATGCACGACCTCCTCACTCCCGTCGTCTCCAAGACGAAACCTCTGTCGCCACTCGTAGAGGACTTCCG
CGTCATAAAGAGCCCAGCCGAGGTGGAGAACATGAGAAGAGCCGGGCGCGCGTCCGGCCGGGCCTTCACAAACGC
CATGCGCACAGCTTGGGACAGCGAGAGACATGTACACGCCTTCCTCGACTATCAGTTCGTCACCAACGGCTGCGA
CGGTACCGCATACGTGCCTGTCGTCGCTGGCGGCGATCGAGCCAACTGCATCCACTACACCGCCAACAACGACGT
CTTCCGAGACGGCGAACTGATTCTCGTCGACGCCGGCGGCGAGTGCGGCTCATACGTGACGGACATTTCCCGCAC
CTGGCCCGTCAACGGCCGCTTCTCCCCCGCCCAGCGAGACCTTTACGAAGCCGTCCTCCGCGTCCAGCGCCACGG
CGTCGGACTCTGCCGCGAATCAGCCAACACGTCGCTCAACGAAATCCACAAAATCACGGAGCAGAAACTAGAAGC
CGAGCTGCGGGACCTCGGCTTCGACAAGAGCAGGATGAGCCAGCTCTTCCCCCACCACGTCGGCCACTACGTCGG
CCTCGACGTCCACGACTGTTCCAGCGTCAGCCGCTCGGAGAAGCTGCGCAAGGGTCACTGCCTCACCATCGAACC
GGGCGTCTACGTGCCTGACGAAGCCGGCTGGCCCAAACACTTCCGCGGGACGGGTATCCGTATCGAGGACAGCGT
CTGCGTCGACCGAGATTCGCCGCTCATCCTAACGACCGAGGCCGTCAAGGAGATAGCCGACATCGAGGCCCTTCG
GTCTCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail