Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01488
Gene name
Locationscaffold_01:5135536..5137386
Strand-
Gene length (bp)1850
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 425 447 22
3 454 473 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 17.10 8.08 26.13
Alive In ants, during behavior modification 32.31 14.34 50.29
Dead In ants, recently dead 28.73 15.08 42.39

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.005285 yes
Alive Dead 0.592323 no
Dead Fungus 0.012301 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01488
MTRQAKKRYGLRGLCVWYLFVSFAEATVWGAGFFQDRSRPSTRLRMDSRGPPQPIPSSSKSAQIYAVALRELQEL
ESEPLCHRIAARLLVNNCQLLDGQDDATILTDSGRATRDFVDFFAASLAICDLERGSFAIPQSCSHFREPFLAEL
PIPNKPQLHVSPSQIDNCLRGLARSDSAWNTWVSYRHKALRFCDAARADNDKDSKIHVFQRVTKVMDKMASQMEA
ELDARFEVLNKMFRDTSANVEGISPKLDELRAGLVRLWQNVSRDVYQGTQQTANSLNKGLKSAQGLEKLLQRLLT
TTLEHDERVRRSHELALRAATSSLSSDVGTVMALLETAVEASTSLHRELMESRSRAAEITQSQERLEAGMQRLSK
TASALSVEQERQTAMLEQAQQSARQLSDMLISVSATAVKFRKSLIGGFGFVRWWPCFVFPIVVLVVGSYGLAPSA
ARNMVLVCLGGSFGFLMLLLRQGSGGWADDGLMPATSTAYANASAYSGYG*
Coding >Ophcf2|01488
ATGACGCGTCAGGCCAAGAAGCGTTACGGGCTTCGCGGCCTCTGCGTCTGGTACCTCTTCGTCTCTTTTGCCGAG
GCCACCGTCTGGGGCGCTGGTTTCTTTCAAGATAGATCAAGGCCCTCAACCCGGTTACGTATGGATTCTCGTGGC
CCTCCTCAGCCGATACCATCGAGTTCAAAATCTGCCCAAATATACGCCGTTGCCTTACGCGAGCTTCAGGAGCTT
GAATCAGAGCCTCTCTGCCACCGCATCGCCGCGCGCCTGCTCGTCAACAACTGCCAGCTGCTGGATGGTCAAGAT
GATGCGACTATTTTGACCGACAGCGGCAGGGCTACGAGAGATTTTGTCGACTTCTTCGCAGCCAGTCTCGCCATC
TGCGACCTCGAGCGAGGAAGCTTCGCCATACCCCAATCTTGTTCCCATTTTCGCGAGCCCTTCCTGGCCGAGTTG
CCGATACCTAACAAGCCCCAGCTCCACGTGTCGCCATCCCAGATCGATAACTGCCTCCGAGGTCTTGCTCGGTCC
GACTCGGCATGGAACACGTGGGTCAGTTACAGGCACAAGGCTTTGAGGTTCTGCGACGCGGCGCGGGCCGACAAC
GACAAAGACAGCAAGATTCACGTCTTTCAAAGAGTCACGAAAGTCATGGACAAGATGGCGAGCCAGATGGAAGCA
GAGCTCGACGCTCGGTTTGAAGTCTTGAACAAGATGTTCAGAGACACCTCAGCCAACGTTGAAGGCATCAGTCCA
AAACTCGACGAGCTGAGGGCTGGCCTTGTCAGGCTTTGGCAGAACGTATCCCGGGATGTATATCAGGGCACACAG
CAAACGGCAAACAGTTTGAACAAGGGCCTGAAGAGCGCACAAGGCCTGGAGAAGCTGTTGCAAAGGTTGCTGACG
ACGACGCTGGAGCACGACGAGAGAGTTAGGCGCTCGCACGAGTTGGCATTGCGTGCGGCGACGAGCAGCCTCAGC
TCCGATGTTGGGACGGTCATGGCATTGCTCGAGACGGCGGTCGAGGCCTCGACGAGCCTACATCGGGAGCTCATG
GAGTCGCGATCTCGAGCAGCTGAAATAACTCAAAGTCAAGAAAGACTCGAAGCGGGCATGCAGCGGCTATCCAAG
ACTGCCAGTGCCCTGAGCGTCGAGCAAGAGCGCCAGACGGCGATGCTGGAGCAGGCGCAACAGTCGGCTAGGCAA
CTATCAGACATGCTGATATCAGTCTCGGCAACAGCCGTCAAGTTTCGAAAGTCGCTGATTGGGGGTTTCGGCTTT
GTGAGATGGTGGCCGTGCTTCGTTTTTCCGATAGTGGTGCTCGTGGTGGGATCGTACGGTCTCGCTCCATCGGCT
GCAAGGAACATGGTTCTCGTCTGCCTGGGGGGGAGCTTTGGGTTCCTGATGCTCTTGTTGAGGCAGGGCAGCGGC
GGCTGGGCGGACGATGGCCTGATGCCCGCCACCTCGACGGCGTACGCGAACGCTTCTGCCTACTCGGGCTACGGT
TGA
Transcript >Ophcf2|01488
ATGACGCGTCAGGCCAAGAAGCGTTACGGGCTTCGCGGCCTCTGCGTCTGGTACCTCTTCGTCTCTTTTGCCGAG
GCCACCGTCTGGGGCGCTGGTTTCTTTCAAGATAGATCAAGGCCCTCAACCCGGTTACGTATGGATTCTCGTGGC
CCTCCTCAGCCGATACCATCGAGTTCAAAATCTGCCCAAATATACGCCGTTGCCTTACGCGAGCTTCAGGAGCTT
GAATCAGAGCCTCTCTGCCACCGCATCGCCGCGCGCCTGCTCGTCAACAACTGCCAGCTGCTGGATGGTCAAGAT
GATGCGACTATTTTGACCGACAGCGGCAGGGCTACGAGAGATTTTGTCGACTTCTTCGCAGCCAGTCTCGCCATC
TGCGACCTCGAGCGAGGAAGCTTCGCCATACCCCAATCTTGTTCCCATTTTCGCGAGCCCTTCCTGGCCGAGTTG
CCGATACCTAACAAGCCCCAGCTCCACGTGTCGCCATCCCAGATCGATAACTGCCTCCGAGGTCTTGCTCGGTCC
GACTCGGCATGGAACACGTGGGTCAGTTACAGGCACAAGGCTTTGAGGTTCTGCGACGCGGCGCGGGCCGACAAC
GACAAAGACAGCAAGATTCACGTCTTTCAAAGAGTCACGAAAGTCATGGACAAGATGGCGAGCCAGATGGAAGCA
GAGCTCGACGCTCGGTTTGAAGTCTTGAACAAGATGTTCAGAGACACCTCAGCCAACGTTGAAGGCATCAGTCCA
AAACTCGACGAGCTGAGGGCTGGCCTTGTCAGGCTTTGGCAGAACGTATCCCGGGATGTATATCAGGGCACACAG
CAAACGGCAAACAGTTTGAACAAGGGCCTGAAGAGCGCACAAGGCCTGGAGAAGCTGTTGCAAAGGTTGCTGACG
ACGACGCTGGAGCACGACGAGAGAGTTAGGCGCTCGCACGAGTTGGCATTGCGTGCGGCGACGAGCAGCCTCAGC
TCCGATGTTGGGACGGTCATGGCATTGCTCGAGACGGCGGTCGAGGCCTCGACGAGCCTACATCGGGAGCTCATG
GAGTCGCGATCTCGAGCAGCTGAAATAACTCAAAGTCAAGAAAGACTCGAAGCGGGCATGCAGCGGCTATCCAAG
ACTGCCAGTGCCCTGAGCGTCGAGCAAGAGCGCCAGACGGCGATGCTGGAGCAGGCGCAACAGTCGGCTAGGCAA
CTATCAGACATGCTGATATCAGTCTCGGCAACAGCCGTCAAGTTTCGAAAGTCGCTGATTGGGGGTTTCGGCTTT
GTGAGATGGTGGCCGTGCTTCGTTTTTCCGATAGTGGTGCTCGTGGTGGGATCGTACGGTCTCGCTCCATCGGCT
GCAAGGAACATGGTTCTCGTCTGCCTGGGGGGGAGCTTTGGGTTCCTGATGCTCTTGTTGAGGCAGGGCAGCGGC
GGCTGGGCGGACGATGGCCTGATGCCCGCCACCTCGACGGCGTACGCGAACGCTTCTGCCTACTCGGGCTACGGT
TGA
Gene >Ophcf2|01488
ATGACGCGTCAGGCCAAGAAGCGTTACGGGCTTCGCGGCCTCTGCGTCTGGTACCTCTTCGTCTCTTTTGCCGAG
GCCACCGTCTGGGGCGCTGGTTTCTTTCAAGATAGTAGGAGGTGCCTCAGACATCAAGGTCGTCTTCGCTGCCTA
ACCATGACAAATTAGGATCAAGGCCCTCAACCCGGTTACGTATGGATTCTCGTGGCCCTCCTCAGCCGATACCAT
CGAGTTCAAAATCTGCCCAAATATACGCCGTTGCCTTACGCGAGCTTCAGGAGCTTGAATCAGAGCCTCTCTGCC
ACCGCATCGCCGCGCGCCTGCTCGTCAACAACTGCCAGCTGCTGGATGGTCAAGATGATGCGACTATTTTGACCG
ACAGCGGCAGGGCTACGAGAGATTTTGTCGACTTCTTCGCAGCCAGTCTCGCCATCTGCGACCTCGAGCGAGGAA
GCTTCGCCATACCCCAATCTTGTTCCCATTTTCGCGAGCCCTTCCTGGCCGAGTTGCCGATACCTAACAAGCCCC
AGCTCCACGTGTCGCCATCCCAGATCGATAACTGCCTCCGAGGTCTTGCTCGGTCCGACTCGGCATGGAACACGT
GGGTCAGTTACAGGCACAAGGCTTTGAGGTTCTGCGACGCGGCGCGGGCCGACAACGACAAAGGTCTGTCTCTTA
CTCGGTGATGCACTTAGCCTGTTCTGACAAGGTTGTTCCCCCCACAGACAGCAAGATTCACGTCTTTCAAAGAGT
CACGAAAGTCATGGACAAGATGGCGAGCCAGATGGAAGCAGAGCTCGACGCTCGGTTTGAAGTCTTGAACAAGAT
GTTCAGAGACACCTCAGCCAACGTTGAAGGCATCAGTCCAAAACTCGACGAGCTGAGGGCTGGCCTTGTCAGGCT
TTGGCAGAACGTATCCCGGGATGTATATCAGGGCACACAGGTAAAGGCTTCCGGACCTGCCCAAGCAGTTGCGTC
CTCGCTAACATGGCTGGTAGCAAACGGCAAACAGTTTGAACAAGGGCCTGAAGAGCGCACAAGGCCTGGAGAAGC
TGTTGCAAAGGTTGCTGACGACGACGCTGGAGCACGACGAGAGAGTTAGGCGCTCGCACGAGTTGGCATTGCGTG
CGGCGACGAGCAGCCTCAGCTCCGATGTTGGGACGGTCATGGCATTGCTCGAGACGGCGGTCGAGGCCTCGACGA
GCCTACATCGGGAGCTCGTAAGCTGACCTTGTGTGTTGCTGCAGTAAGCACAGATTGGCTGATGTCGTTGTTCGG
TGGCAGATGGAGTCGCGATCTCGAGCAGCTGAAATAACTCAAAGTCAAGAAAGACTCGAAGCGGTAGGTGGCGTT
GCGTCTCGAGTTCTGTGTTGGTTGCACTGACGCGCATCCGATGTAGGGCATGCAGCGGCTATCCAAGACTGCCAG
TGCCCTGAGCGTCGAGCAAGAGCGCCAGACGGCGATGCTGGAGCAGGCGCAACAGTCGGCTAGGCAACTATCAGA
CATGCTGATATCAGTCTCGGCAACAGCCGTCAAGTTTCGAAAGTCGCTGATTGGGGGTTTCGGCTTTGTGAGATG
GTGGCCGTGCTTCGTTTTTCCGATAGTGGTGCTCGTGGTGGGATCGTACGGTCTCGCTCCATCGGCTGCAAGGAA
CATGGTTCTCGTCTGCCTGGGTAAGCGTCTGAGCCGGACGAGGCTTCTCGGGGGCGCGCTGACGAGTGGCTGCAG
GGGGGAGCTTTGGGTTCCTGATGCTCTTGTTGAGGCAGGGCAGCGGCGGCTGGGCGGACGATGGCCTGATGCCCG
CCACCTCGACGGCGTACGCGAACGCTTCTGCCTACTCGGGCTACGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail