Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01485
Gene name
Locationscaffold_01:5128796..5130829
Strand+
Gene length (bp)2033
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11626 Rap1_C TRF2-interacting telomeric protein/Rap1 - C terminal domain 2.8E-20 534 633
PF08914 Myb_DNA-bind_2 Rap1 Myb domain 5.0E-14 104 157
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 7.1E-07 17 91

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2221 0.9577 0.15 0.013 0.0635 0.0064 0.0102 0.0109 0.0063 0.041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4339
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|548
Ophiocordyceps australis map64 (Brazil) OphauB2|888
Ophiocordyceps camponoti-floridani Ophcf2|01485 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2535
Ophiocordyceps kimflemingae Ophio5|3859
Ophiocordyceps subramaniannii Hirsu2|8914

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01485
MSQVVVDDDVASGQGGNMFQGKRFWVARTVPTRPVVLEHITSNGGIVAALEKDADFLIANPAKKEAPAGSYSWEL
ILDSVKNGIMQPEDRYYIAGTQGKAAKYGRIAFTHEDDITLSRWVMKHKKGFLGNNIYKDLECQNPRHTWQSWKS
HFTSKLHFKGWDYITKLAAEKLAGEDDEVVESSAQADAAVAPSTSPTRENDAASEMQTDEESESSRDHLYRLVGI
YRDEMGIQNDHVHEHVIGGKLLDLWELKNAVCQQEAATEDVDWQRVAKDVDAEWEGDAQICGELQECFEKNLEPV
LRLMSAYKSRKDGDDVDGEGSQPSADRSSAPATMPSSPPGQTPRGKRQREAETDSPGAGVKRPRRHDGEVSIPST
PESRIGLLRPSPRATGVSSAQTERLPVVGESGMQPERDSPSPSRQLLSEAAQLQHRGSHSDPVRRQTNRIGSEEA
GPRTSPRRRSTRNVSGSSVTARESVKPVRRTLPSTFGSSANKGSPLGQRRQKGQVRWAAGTGSRSRPEALSSEEA
NLLDRIQDYVSLGYAERIVMEALKSTSMRAGGAAAHAMQSLKEGKGIPTNVEGAWTAKDDGHLVRADEVMARGAD
AGAAERKRAGERLRRLEHKHGAESLELRRRYLADLAVAMGS*
Coding >Ophcf2|01485
ATGTCGCAAGTAGTCGTCGACGACGATGTCGCCAGCGGACAAGGCGGCAACATGTTCCAAGGAAAGCGCTTCTGG
GTCGCAAGGACGGTTCCCACGCGGCCGGTCGTGTTAGAGCACATCACTAGTAACGGCGGCATCGTGGCAGCTTTG
GAGAAGGACGCCGATTTCCTCATCGCCAACCCCGCCAAGAAGGAAGCCCCTGCCGGCTCATACTCGTGGGAATTG
ATACTGGACTCGGTCAAGAATGGAATTATGCAGCCGGAGGACCGATATTACATTGCTGGGACGCAAGGGAAAGCG
GCCAAGTACGGAAGAATCGCCTTTACGCATGAAGACGACATCACCCTGTCTCGGTGGGTCATGAAGCACAAGAAA
GGATTTCTAGGGAACAACATCTATAAAGATCTTGAGTGTCAGAATCCTCGACACACGTGGCAATCGTGGAAAAGC
CACTTCACGTCGAAGCTGCATTTCAAAGGATGGGACTACATTACCAAGCTAGCGGCCGAGAAGCTGGCGGGAGAA
GACGATGAGGTCGTGGAAAGCTCGGCGCAGGCGGACGCTGCAGTCGCGCCCTCGACGTCACCGACTCGAGAGAAC
GATGCAGCCTCCGAGATGCAGACGGATGAAGAGTCGGAGTCGTCGAGAGACCATCTTTACCGCCTGGTTGGAATA
TATCGCGATGAGATGGGCATTCAGAACGACCATGTCCATGAACACGTCATCGGGGGTAAGCTCCTCGATCTCTGG
GAGTTGAAAAACGCCGTCTGCCAGCAAGAAGCTGCCACCGAAGACGTGGACTGGCAACGAGTCGCCAAAGATGTC
GACGCCGAGTGGGAGGGCGACGCGCAGATATGTGGTGAACTGCAGGAGTGTTTTGAAAAGAACCTCGAACCCGTT
CTGCGGCTGATGTCTGCTTACAAGTCGCGCAAGGACGGCGATGATGTCGACGGAGAAGGCTCGCAGCCGTCAGCA
GACCGTTCATCGGCTCCAGCCACGATGCCGTCCTCGCCACCTGGGCAGACTCCGCGCGGAAAGCGACAGAGGGAG
GCTGAGACGGACAGCCCCGGTGCAGGCGTGAAGCGACCACGGCGTCACGATGGAGAGGTTTCGATCCCGTCGACG
CCCGAGAGCAGGATCGGTCTACTCAGGCCTTCACCTCGAGCAACAGGCGTATCCTCTGCTCAGACGGAACGGCTA
CCGGTCGTCGGGGAATCGGGGATGCAGCCGGAGCGAGACTCGCCCAGTCCCTCACGGCAACTCCTTTCCGAAGCG
GCGCAGCTGCAGCACAGGGGCAGTCACAGCGATCCCGTACGCCGGCAAACGAACCGCATCGGCAGTGAGGAAGCA
GGTCCCAGGACGAGTCCCCGCCGCCGGTCGACGCGAAACGTGAGCGGATCGAGCGTCACAGCACGAGAAAGCGTC
AAGCCCGTGAGGCGAACTCTCCCGTCGACCTTTGGCTCGTCCGCGAACAAGGGCAGCCCTCTCGGCCAGCGAAGG
CAGAAAGGTCAAGTCAGATGGGCAGCCGGAACTGGTAGCCGGTCTCGACCCGAAGCCCTAAGCAGCGAAGAAGCA
AACCTCCTGGACAGAATACAAGACTACGTATCTCTCGGATACGCGGAGCGCATCGTCATGGAAGCGCTGAAGAGC
ACATCAATGAGAGCCGGCGGCGCGGCAGCACACGCAATGCAAAGCCTCAAGGAAGGAAAAGGCATCCCCACCAAC
GTCGAAGGCGCGTGGACGGCAAAGGACGACGGCCATCTCGTCCGGGCAGACGAGGTCATGGCACGGGGTGCCGAT
GCCGGCGCTGCGGAGAGGAAGAGGGCGGGAGAGAGGCTCCGGAGGCTGGAGCATAAGCATGGGGCTGAGAGCTTG
GAGCTTCGGAGGCGGTATCTGGCGGACTTGGCCGTGGCTATGGGGAGTTGA
Transcript >Ophcf2|01485
ATGTCGCAAGTAGTCGTCGACGACGATGTCGCCAGCGGACAAGGCGGCAACATGTTCCAAGGAAAGCGCTTCTGG
GTCGCAAGGACGGTTCCCACGCGGCCGGTCGTGTTAGAGCACATCACTAGTAACGGCGGCATCGTGGCAGCTTTG
GAGAAGGACGCCGATTTCCTCATCGCCAACCCCGCCAAGAAGGAAGCCCCTGCCGGCTCATACTCGTGGGAATTG
ATACTGGACTCGGTCAAGAATGGAATTATGCAGCCGGAGGACCGATATTACATTGCTGGGACGCAAGGGAAAGCG
GCCAAGTACGGAAGAATCGCCTTTACGCATGAAGACGACATCACCCTGTCTCGGTGGGTCATGAAGCACAAGAAA
GGATTTCTAGGGAACAACATCTATAAAGATCTTGAGTGTCAGAATCCTCGACACACGTGGCAATCGTGGAAAAGC
CACTTCACGTCGAAGCTGCATTTCAAAGGATGGGACTACATTACCAAGCTAGCGGCCGAGAAGCTGGCGGGAGAA
GACGATGAGGTCGTGGAAAGCTCGGCGCAGGCGGACGCTGCAGTCGCGCCCTCGACGTCACCGACTCGAGAGAAC
GATGCAGCCTCCGAGATGCAGACGGATGAAGAGTCGGAGTCGTCGAGAGACCATCTTTACCGCCTGGTTGGAATA
TATCGCGATGAGATGGGCATTCAGAACGACCATGTCCATGAACACGTCATCGGGGGTAAGCTCCTCGATCTCTGG
GAGTTGAAAAACGCCGTCTGCCAGCAAGAAGCTGCCACCGAAGACGTGGACTGGCAACGAGTCGCCAAAGATGTC
GACGCCGAGTGGGAGGGCGACGCGCAGATATGTGGTGAACTGCAGGAGTGTTTTGAAAAGAACCTCGAACCCGTT
CTGCGGCTGATGTCTGCTTACAAGTCGCGCAAGGACGGCGATGATGTCGACGGAGAAGGCTCGCAGCCGTCAGCA
GACCGTTCATCGGCTCCAGCCACGATGCCGTCCTCGCCACCTGGGCAGACTCCGCGCGGAAAGCGACAGAGGGAG
GCTGAGACGGACAGCCCCGGTGCAGGCGTGAAGCGACCACGGCGTCACGATGGAGAGGTTTCGATCCCGTCGACG
CCCGAGAGCAGGATCGGTCTACTCAGGCCTTCACCTCGAGCAACAGGCGTATCCTCTGCTCAGACGGAACGGCTA
CCGGTCGTCGGGGAATCGGGGATGCAGCCGGAGCGAGACTCGCCCAGTCCCTCACGGCAACTCCTTTCCGAAGCG
GCGCAGCTGCAGCACAGGGGCAGTCACAGCGATCCCGTACGCCGGCAAACGAACCGCATCGGCAGTGAGGAAGCA
GGTCCCAGGACGAGTCCCCGCCGCCGGTCGACGCGAAACGTGAGCGGATCGAGCGTCACAGCACGAGAAAGCGTC
AAGCCCGTGAGGCGAACTCTCCCGTCGACCTTTGGCTCGTCCGCGAACAAGGGCAGCCCTCTCGGCCAGCGAAGG
CAGAAAGGTCAAGTCAGATGGGCAGCCGGAACTGGTAGCCGGTCTCGACCCGAAGCCCTAAGCAGCGAAGAAGCA
AACCTCCTGGACAGAATACAAGACTACGTATCTCTCGGATACGCGGAGCGCATCGTCATGGAAGCGCTGAAGAGC
ACATCAATGAGAGCCGGCGGCGCGGCAGCACACGCAATGCAAAGCCTCAAGGAAGGAAAAGGCATCCCCACCAAC
GTCGAAGGCGCGTGGACGGCAAAGGACGACGGCCATCTCGTCCGGGCAGACGAGGTCATGGCACGGGGTGCCGAT
GCCGGCGCTGCGGAGAGGAAGAGGGCGGGAGAGAGGCTCCGGAGGCTGGAGCATAAGCATGGGGCTGAGAGCTTG
GAGCTTCGGAGGCGGTATCTGGCGGACTTGGCCGTGGCTATGGGGAGTTGA
Gene >Ophcf2|01485
ATGTCGCAAGTAGTCGTCGACGACGATGTCGCCAGCGGACAAGGCGGCAACATGTTCCAAGGAAAGCGCTTCTGG
GTCGCAAGGACGGTTCCCACGCGGCCGGTCGTGTTAGAGCACATCACTGTGAGTCCAGATAGCGGCCATGTCGAT
ACAGAGCACGGGCTGACTGCGGCGGTAGAGTAACGGCGGCATCGTGGCAGCTTTGGAGAAGGACGCCGATTTCCT
CATCGCCAACCCCGCCAAGAAGGAAGCCCCTGCCGGCTCATACTCGTGGGAATTGATACTGGACTCGGTCAAGAA
TGGAATTATGCAGCCGGAGGACCGATATTACATTGCTGGGACGCAAGGGAAAGCGGCCAAGTACGGAAGAATCGC
CTTTACGCATGAAGACGACATCACCCTGTCTCGGTGGGTCATGAAGCACAAGAAAGGATTTCTAGGGAACAACAT
CTATAAAGATCTTGAGTGTCAGGTGCGGTGCATCTTTGCGCGTCGCGTCTTACTCTTCGTCTAACACGTGTCAGA
ATCCTCGACACACGTGGCAATCGTGGAAAAGCCACTTCACGTCGAAGCTGCATTTCAAAGGATGGGACTACATTA
CCAAGCTAGCGGCCGAGAAGCTGGCGGGAGAAGACGATGAGGTCGTGGAAAGCTCGGCGCAGGCGGACGCTGCAG
TCGCGCCCTCGACGTCACCGACTCGAGAGAACGATGCAGCCTCCGAGATGCAGACGGATGAAGAGTCGGAGTCGT
CGAGAGACCATCTTTACCGCCTGGTTGGAATATATCGCGATGAGATGGGCATTCAGAACGACCATGTCCATGAAC
ACGTCATCGGGGGTAAGCTCCTCGATCTCTGGGAGTTGAAAAACGCCGTCTGCCAGCAAGAAGCTGCCACCGAAG
ACGTGGACTGGCAACGAGTCGCCAAAGATGTCGACGCCGAGTGGGAGGGCGACGCGCAGATATGTGGTGAACTGC
AGGAGTGTTTTGAAAAGAACCTCGAACCCGTTCTGCGGCTGATGTCTGCTTACAAGTCGCGCAAGGACGGCGATG
ATGTCGACGGAGAAGGCTCGCAGCCGTCAGCAGACCGTTCATCGGCTCCAGCCACGATGCCGTCCTCGCCACCTG
GGCAGACTCCGCGCGGAAAGCGACAGAGGGAGGCTGAGACGGACAGCCCCGGTGCAGGCGTGAAGCGACCACGGC
GTCACGATGGAGAGGTTTCGATCCCGTCGACGCCCGAGAGCAGGATCGGTCTACTCAGGCCTTCACCTCGAGCAA
CAGGCGTATCCTCTGCTCAGACGGAACGGCTACCGGTCGTCGGGGAATCGGGGATGCAGCCGGAGCGAGACTCGC
CCAGTCCCTCACGGCAACTCCTTTCCGAAGCGGCGCAGCTGCAGCACAGGGGCAGTCACAGCGATCCCGTACGCC
GGCAAACGAACCGCATCGGCAGTGAGGAAGCAGGTCCCAGGACGAGTCCCCGCCGCCGGTCGACGCGAAACGTGA
GCGGATCGAGCGTCACAGCACGAGAAAGCGTCAAGCCCGTGAGGCGAACTCTCCCGTCGACCTTTGGCTCGTCCG
CGAACAAGGGCAGCCCTCTCGGCCAGCGAAGGCAGAAAGGTCAAGTCAGATGGGCAGCCGGAACTGGTAGCCGGT
CTCGACCCGAAGCCCTAAGCAGCGAAGAAGCAAACCTCCTGGACAGAATACAAGACTACGTATCTCTCGGATACG
CGGAGCGCATCGTCATGGAAGCGCTGAAGAGCACATCAATGAGAGCCGGCGGCGCGGCAGCACACGCAATGCAAA
GCCTCAAGGAAGGAAAAGGCATCCCCACCAACGTCGAAGGCGCGTGGACGGCAAAGGACGACGGCCATCTCGTCC
GGGCAGACGAGGTCATGGCACGGGGTGCCGATGCCGGCGCTGCGGAGAGGAAGAGGGCGGGAGAGAGGCTCCGGA
GGCTGGAGCATAAGCATGGGGCTGAGAGCTTGGAGCTTCGGAGGCGGTATCTGGCGGACTTGGCCGTGGCTATGG
GGAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail