Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01476
Gene name
Locationscaffold_01:5105378..5108944
Strand-
Gene length (bp)3566
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20162 Etd1 Septation protein etd1 7.5E-09 820 882

GO

GO Term Description Terminal node
GO:0005096 GTPase activator activity Yes
GO:1902412 regulation of mitotic cytokinesis Yes
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0010564 regulation of cell cycle process No
GO:0051302 regulation of cell division No
GO:0050789 regulation of biological process No
GO:0008150 biological_process No
GO:0051726 regulation of cell cycle No
GO:0008047 enzyme activator activity No
GO:0003674 molecular_function No
GO:0032465 regulation of cytokinesis No
GO:0030234 enzyme regulator activity No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7491 0.3279 0.0635 0.3202 0.1696 0.0388 0.169 0.1709 0.1106 0.3358

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4322
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1362
Ophiocordyceps australis map64 (Brazil) OphauB2|897
Ophiocordyceps camponoti-floridani Ophcf2|01476 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2543
Ophiocordyceps kimflemingae Ophio5|3848
Ophiocordyceps subramaniannii Hirsu2|8873

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01476
MQTVPSLVGSGTAIAAAASGLVFGQHSHQPTAAAESGSVRTRRSSHRRTVSADQTLAVRDSLVSPRPATISPGHE
PSHHRTTSHPQPCSRPPLSRRQRPKNSQSLSSPRSVEPPSSVAPAARRDSVSSNGSWIRKLSIRPLSQHGSARSS
IIAEGPSVTFSDPWPGLDSSSSHNPNKLVKRPSTARAGPSLGDISPRQWPRSHLSTLRRPITSHQRPGTALLFRP
DFHVPSTPPSKHSFDRPVRPEELLGVSPYHVALDPDSAWTSFFHSRSCKLVAIPRFQDSPGDASRSTSTFSLKRI
LPGGGRRNPPPHLVKPRMLSSSPGSGPSPSSAYTAPGRTPKPLQDFPASDEATPPTRTIRSLSASLSSASSWVSK
RSGSLRRSKKGSDRRGGKSRPHESEPPESTACHSPAHQQGLRSSSEDPSELSVASKMHRQRVPGPLNQTLHGRLP
MCDEKASFPEAPLSSSHSGLGRGGNDFSRSAGRPHGTMTRQIRPNHASGSSTSSTVMSQLARVSLHERSPVMEGS
DGEARGFTSGDDDDTDLKSDTVFDSLRTLASSRARVVETPLESVYDESPPSTAGKTTRLSVQEMLGASWEEGNRI
TEEDDENHLAPSQHGGVGFCKAGPAMFITMPRFGAASSPTRTGNSPLEAVMNDCDGEDEDWTRDDDMSFSNSLSA
HPEKPLAGLGGMNPKVQIALPGAQTKTAAERPLSNLFDWSEPPTHGKHESDGGSLRPRTAYVIPLVDSRGGRTAV
RKGPMPTHVRSQSVPVVHDPPEESKPAGPKYGTWGLGTKTVSEDWDEDFEFGAASGDGKDEANGKSRENVFAVPE
SIRATQPSVRAHSGQIRELSLLVNDLKRLFRHGRELDMLDGEQTGLWREAEGIITLASPDEDDAGHDGQTEAKND
REPDQWGGSKDSSEPSKWRTAVVRERQSPRRRSVFSSEDDIFGTSWPVSEESSRQSDDKGASDVSGVVRCVMESL
RKPQRGAARLARSNDVCNGRVQFDTNNLKELVKRAGELRDALSDMIRKADWMTQSPMATPRHECRLDSSPAFTRV
FDDPCSTPPRRTTRTRGSNSLMDEVSSPNKSPSSPMGPQAAVMTVN*
Coding >Ophcf2|01476
ATGCAGACGGTCCCCAGTCTCGTCGGCTCCGGCACTGCCATCGCTGCAGCAGCCAGTGGCTTAGTCTTCGGCCAA
CACTCTCATCAACCAACAGCCGCAGCCGAATCTGGCTCCGTTCGGACTCGACGCTCTTCCCATCGGAGGACCGTT
TCTGCGGATCAAACTTTGGCCGTCAGAGATAGCCTCGTCTCTCCTCGACCGGCAACTATCTCGCCAGGCCACGAG
CCTTCGCATCATCGCACTACATCTCACCCCCAGCCTTGCTCGCGTCCTCCTCTATCCCGCCGCCAGCGTCCCAAG
AACTCGCAAAGCCTGTCCTCGCCAAGATCCGTCGAGCCTCCGTCGTCTGTTGCCCCCGCAGCCCGTCGAGATTCC
GTTTCATCCAATGGCTCTTGGATAAGGAAGCTTTCGATTCGCCCTTTATCCCAACACGGCAGTGCACGGTCCAGC
ATCATTGCCGAAGGCCCTTCTGTCACCTTCTCCGACCCTTGGCCAGGTCTCGATTCTTCATCCTCTCACAACCCC
AACAAACTCGTCAAGCGACCTTCGACGGCTCGTGCCGGCCCGAGCTTGGGAGATATCTCTCCTCGTCAGTGGCCC
AGAAGCCATCTGTCAACCTTGCGTCGGCCCATTACGAGCCACCAACGCCCCGGCACTGCGCTCCTCTTTCGTCCC
GATTTCCATGTCCCGAGCACTCCTCCTTCCAAGCACTCGTTTGACAGGCCCGTCCGGCCCGAAGAGCTGCTGGGC
GTGTCGCCTTATCACGTCGCACTAGACCCCGACTCTGCATGGACATCGTTCTTTCACTCGAGATCCTGCAAGCTA
GTCGCCATTCCTCGTTTCCAGGATTCTCCCGGCGATGCCAGTCGCTCCACATCAACATTTTCTTTGAAGAGAATC
CTCCCTGGAGGAGGCAGACGGAATCCGCCGCCGCATCTGGTCAAGCCGAGGATGCTATCCTCTTCGCCGGGCTCA
GGACCAAGCCCCTCTTCTGCCTACACCGCTCCTGGCCGAACCCCCAAGCCTCTTCAAGACTTTCCCGCCTCGGAC
GAGGCCACTCCTCCGACACGGACGATACGATCGCTGTCTGCCAGTCTCTCTTCGGCCAGTAGTTGGGTCTCGAAA
CGATCCGGCAGTCTCCGCCGATCCAAGAAAGGCTCTGATCGAAGAGGCGGCAAATCCAGACCGCACGAATCCGAG
CCACCAGAAAGCACCGCTTGCCATTCCCCAGCCCATCAGCAAGGTCTTCGCTCGTCGTCTGAGGACCCCAGCGAG
TTGTCGGTGGCCTCCAAGATGCATCGGCAGCGGGTGCCGGGACCCTTGAACCAGACTCTCCACGGTCGGCTGCCC
ATGTGCGATGAGAAGGCGTCTTTCCCAGAAGCTCCTCTATCGTCCAGTCATTCTGGTTTGGGTCGTGGGGGTAAC
GACTTCTCACGCTCAGCCGGTCGCCCCCATGGCACCATGACTCGCCAAATTCGACCCAACCATGCGTCGGGAAGC
TCGACGAGTTCCACCGTCATGTCCCAGTTGGCCAGAGTGTCACTCCACGAGCGGTCCCCTGTCATGGAGGGCTCC
GACGGCGAGGCTCGGGGATTCACTTCCGGGGACGACGATGACACCGACCTCAAGAGTGACACCGTCTTCGACTCG
CTGCGAACGCTCGCCTCGTCGCGTGCGAGGGTTGTCGAGACGCCTCTCGAGTCTGTATACGACGAGTCTCCCCCA
AGCACAGCCGGCAAGACGACACGACTTTCTGTGCAGGAGATGCTGGGAGCAAGCTGGGAGGAAGGGAATCGGATC
ACGGAAGAAGACGACGAGAACCACTTGGCCCCGTCTCAGCATGGCGGTGTCGGCTTTTGCAAAGCTGGACCTGCC
ATGTTCATCACTATGCCTCGCTTTGGAGCAGCTTCGTCACCAACGAGGACTGGAAACTCTCCGCTGGAGGCCGTC
ATGAACGATTGTGATGGTGAAGACGAAGACTGGACGAGGGATGACGACATGTCTTTCAGTAACTCGCTCTCAGCT
CACCCCGAGAAACCTTTGGCTGGTCTTGGAGGAATGAACCCCAAGGTCCAGATTGCCCTGCCAGGCGCCCAGACG
AAGACGGCTGCCGAGCGGCCCCTTAGCAACCTCTTTGATTGGAGCGAGCCCCCGACGCACGGCAAGCACGAGAGC
GACGGCGGTTCTCTGCGGCCGCGGACGGCGTATGTCATCCCGCTGGTGGACTCTAGGGGAGGTCGCACAGCGGTC
CGCAAGGGGCCGATGCCGACACACGTGCGAAGCCAGAGCGTCCCCGTCGTTCATGACCCTCCCGAGGAGTCGAAG
CCGGCCGGGCCAAAGTACGGCACCTGGGGTCTGGGAACTAAGACCGTCTCGGAGGATTGGGACGAGGACTTTGAG
TTTGGGGCCGCGAGCGGAGACGGCAAGGACGAGGCCAACGGTAAGAGCCGCGAGAACGTCTTTGCCGTGCCCGAG
TCGATCCGGGCCACGCAGCCCAGCGTCAGAGCGCACTCGGGCCAGATCCGCGAGCTATCTCTCCTGGTCAACGAC
TTGAAGCGCCTGTTTCGTCACGGGCGTGAGCTCGACATGCTCGACGGCGAGCAGACGGGCCTGTGGAGGGAGGCC
GAGGGCATCATCACGCTGGCCTCGCCCGACGAGGACGACGCGGGTCACGACGGTCAGACGGAGGCCAAGAATGAC
CGCGAACCGGATCAGTGGGGCGGTTCCAAGGACAGCTCGGAGCCGAGCAAGTGGAGGACGGCGGTGGTGCGTGAG
CGTCAGTCGCCGAGGCGGCGGTCCGTCTTCTCGTCGGAAGACGACATCTTTGGCACCAGCTGGCCAGTTTCCGAG
GAGAGCAGCCGGCAGTCGGACGACAAAGGGGCCAGCGACGTCAGCGGAGTGGTGCGCTGCGTCATGGAATCGCTA
CGAAAGCCGCAGCGCGGGGCGGCTCGGCTGGCACGGAGCAACGATGTCTGCAACGGCAGGGTGCAGTTCGACACC
AATAACCTCAAGGAGCTGGTCAAGAGGGCCGGGGAGTTACGGGACGCTCTGTCCGACATGATTCGCAAGGCCGAC
TGGATGACGCAGAGCCCGATGGCTACTCCGCGACACGAGTGCCGGCTCGACTCGAGTCCCGCCTTCACCCGGGTC
TTTGACGATCCCTGCTCGACCCCCCCGCGGCGGACGACTCGGACCCGTGGCAGCAACTCGCTCATGGACGAGGTT
TCGTCTCCGAACAAGTCTCCATCGTCACCCATGGGACCGCAGGCGGCGGTCATGACGGTCAACTAG
Transcript >Ophcf2|01476
ATGCAGACGGTCCCCAGTCTCGTCGGCTCCGGCACTGCCATCGCTGCAGCAGCCAGTGGCTTAGTCTTCGGCCAA
CACTCTCATCAACCAACAGCCGCAGCCGAATCTGGCTCCGTTCGGACTCGACGCTCTTCCCATCGGAGGACCGTT
TCTGCGGATCAAACTTTGGCCGTCAGAGATAGCCTCGTCTCTCCTCGACCGGCAACTATCTCGCCAGGCCACGAG
CCTTCGCATCATCGCACTACATCTCACCCCCAGCCTTGCTCGCGTCCTCCTCTATCCCGCCGCCAGCGTCCCAAG
AACTCGCAAAGCCTGTCCTCGCCAAGATCCGTCGAGCCTCCGTCGTCTGTTGCCCCCGCAGCCCGTCGAGATTCC
GTTTCATCCAATGGCTCTTGGATAAGGAAGCTTTCGATTCGCCCTTTATCCCAACACGGCAGTGCACGGTCCAGC
ATCATTGCCGAAGGCCCTTCTGTCACCTTCTCCGACCCTTGGCCAGGTCTCGATTCTTCATCCTCTCACAACCCC
AACAAACTCGTCAAGCGACCTTCGACGGCTCGTGCCGGCCCGAGCTTGGGAGATATCTCTCCTCGTCAGTGGCCC
AGAAGCCATCTGTCAACCTTGCGTCGGCCCATTACGAGCCACCAACGCCCCGGCACTGCGCTCCTCTTTCGTCCC
GATTTCCATGTCCCGAGCACTCCTCCTTCCAAGCACTCGTTTGACAGGCCCGTCCGGCCCGAAGAGCTGCTGGGC
GTGTCGCCTTATCACGTCGCACTAGACCCCGACTCTGCATGGACATCGTTCTTTCACTCGAGATCCTGCAAGCTA
GTCGCCATTCCTCGTTTCCAGGATTCTCCCGGCGATGCCAGTCGCTCCACATCAACATTTTCTTTGAAGAGAATC
CTCCCTGGAGGAGGCAGACGGAATCCGCCGCCGCATCTGGTCAAGCCGAGGATGCTATCCTCTTCGCCGGGCTCA
GGACCAAGCCCCTCTTCTGCCTACACCGCTCCTGGCCGAACCCCCAAGCCTCTTCAAGACTTTCCCGCCTCGGAC
GAGGCCACTCCTCCGACACGGACGATACGATCGCTGTCTGCCAGTCTCTCTTCGGCCAGTAGTTGGGTCTCGAAA
CGATCCGGCAGTCTCCGCCGATCCAAGAAAGGCTCTGATCGAAGAGGCGGCAAATCCAGACCGCACGAATCCGAG
CCACCAGAAAGCACCGCTTGCCATTCCCCAGCCCATCAGCAAGGTCTTCGCTCGTCGTCTGAGGACCCCAGCGAG
TTGTCGGTGGCCTCCAAGATGCATCGGCAGCGGGTGCCGGGACCCTTGAACCAGACTCTCCACGGTCGGCTGCCC
ATGTGCGATGAGAAGGCGTCTTTCCCAGAAGCTCCTCTATCGTCCAGTCATTCTGGTTTGGGTCGTGGGGGTAAC
GACTTCTCACGCTCAGCCGGTCGCCCCCATGGCACCATGACTCGCCAAATTCGACCCAACCATGCGTCGGGAAGC
TCGACGAGTTCCACCGTCATGTCCCAGTTGGCCAGAGTGTCACTCCACGAGCGGTCCCCTGTCATGGAGGGCTCC
GACGGCGAGGCTCGGGGATTCACTTCCGGGGACGACGATGACACCGACCTCAAGAGTGACACCGTCTTCGACTCG
CTGCGAACGCTCGCCTCGTCGCGTGCGAGGGTTGTCGAGACGCCTCTCGAGTCTGTATACGACGAGTCTCCCCCA
AGCACAGCCGGCAAGACGACACGACTTTCTGTGCAGGAGATGCTGGGAGCAAGCTGGGAGGAAGGGAATCGGATC
ACGGAAGAAGACGACGAGAACCACTTGGCCCCGTCTCAGCATGGCGGTGTCGGCTTTTGCAAAGCTGGACCTGCC
ATGTTCATCACTATGCCTCGCTTTGGAGCAGCTTCGTCACCAACGAGGACTGGAAACTCTCCGCTGGAGGCCGTC
ATGAACGATTGTGATGGTGAAGACGAAGACTGGACGAGGGATGACGACATGTCTTTCAGTAACTCGCTCTCAGCT
CACCCCGAGAAACCTTTGGCTGGTCTTGGAGGAATGAACCCCAAGGTCCAGATTGCCCTGCCAGGCGCCCAGACG
AAGACGGCTGCCGAGCGGCCCCTTAGCAACCTCTTTGATTGGAGCGAGCCCCCGACGCACGGCAAGCACGAGAGC
GACGGCGGTTCTCTGCGGCCGCGGACGGCGTATGTCATCCCGCTGGTGGACTCTAGGGGAGGTCGCACAGCGGTC
CGCAAGGGGCCGATGCCGACACACGTGCGAAGCCAGAGCGTCCCCGTCGTTCATGACCCTCCCGAGGAGTCGAAG
CCGGCCGGGCCAAAGTACGGCACCTGGGGTCTGGGAACTAAGACCGTCTCGGAGGATTGGGACGAGGACTTTGAG
TTTGGGGCCGCGAGCGGAGACGGCAAGGACGAGGCCAACGGTAAGAGCCGCGAGAACGTCTTTGCCGTGCCCGAG
TCGATCCGGGCCACGCAGCCCAGCGTCAGAGCGCACTCGGGCCAGATCCGCGAGCTATCTCTCCTGGTCAACGAC
TTGAAGCGCCTGTTTCGTCACGGGCGTGAGCTCGACATGCTCGACGGCGAGCAGACGGGCCTGTGGAGGGAGGCC
GAGGGCATCATCACGCTGGCCTCGCCCGACGAGGACGACGCGGGTCACGACGGTCAGACGGAGGCCAAGAATGAC
CGCGAACCGGATCAGTGGGGCGGTTCCAAGGACAGCTCGGAGCCGAGCAAGTGGAGGACGGCGGTGGTGCGTGAG
CGTCAGTCGCCGAGGCGGCGGTCCGTCTTCTCGTCGGAAGACGACATCTTTGGCACCAGCTGGCCAGTTTCCGAG
GAGAGCAGCCGGCAGTCGGACGACAAAGGGGCCAGCGACGTCAGCGGAGTGGTGCGCTGCGTCATGGAATCGCTA
CGAAAGCCGCAGCGCGGGGCGGCTCGGCTGGCACGGAGCAACGATGTCTGCAACGGCAGGGTGCAGTTCGACACC
AATAACCTCAAGGAGCTGGTCAAGAGGGCCGGGGAGTTACGGGACGCTCTGTCCGACATGATTCGCAAGGCCGAC
TGGATGACGCAGAGCCCGATGGCTACTCCGCGACACGAGTGCCGGCTCGACTCGAGTCCCGCCTTCACCCGGGTC
TTTGACGATCCCTGCTCGACCCCCCCGCGGCGGACGACTCGGACCCGTGGCAGCAACTCGCTCATGGACGAGGTT
TCGTCTCCGAACAAGTCTCCATCGTCACCCATGGGACCGCAGGCGGCGGTCATGACGGTCAACTAG
Gene >Ophcf2|01476
ATGCAGACGGTCCCCAGTGTAAGTTCCCCCCCCTTGCGCCGCTGCCGCCTCCCGCGTGTCACGACCTGGTCGCCT
AGCTCGACTAAACTTTCCGCCCTTCCTCCACGTCTCTCGTCCTTGGAAATGCTACCCCGACCCTACCTATGTACT
TGTCTTTCACGCCGTGTCTTTTATTTTTATTTTATTTTTTTTGTGTTTTTCTTTCTTCGTTCCCTTCTTTTCTCC
GACGTCTTCTCTCCCTTCCTCCCTTCCTCTCTATCTTTCGTCTTCAAACAGTCTCTAATCAGTTGTAGCTCGTCG
GCTCCGGCACTGCCATCGCTGCAGCAGCCAGTGGCTTAGTCTTCGGCCAACACTCTCATCAACCAACAGCCGCAG
CCGAATCTGGCTCCGTTCGGACTCGACGCTCTTCCCATCGGAGGACCGTTTCTGCGGATCAAACTTTGGCCGTCA
GAGATAGCCTCGTCTCTCCTCGACCGGCAACTATCTCGCCAGGCCACGAGCCTTCGCATCATCGCACTACATCTC
ACCCCCAGCCTTGCTCGCGTCCTCCTCTATCCCGCCGCCAGCGTCCCAAGAACTCGCAAAGCCTGTCCTCGCCAA
GATCCGTCGAGCCTCCGTCGTCTGTTGCCCCCGCAGCCCGTCGAGATTCCGTTTCATCCAATGGCTCTTGGATAA
GGAAGCTTTCGATTCGCCCTTTATCCCAACACGGCAGTGCACGGTCCAGCATCATTGCCGAAGGCCCTTCTGTCA
CCTTCTCCGACCCTTGGCCAGGTCTCGATTCTTCATCCTCTCACAACCCCAACAAACTCGTCAAGCGACCTTCGA
CGGCTCGTGCCGGCCCGAGCTTGGGAGATATCTCTCCTCGTCAGTGGCCCAGAAGCCATCTGTCAACCTTGCGTC
GGCCCATTACGAGCCACCAACGCCCCGGCACTGCGCTCCTCTTTCGTCCCGATTTCCATGTCCCGAGCACTCCTC
CTTCCAAGCACTCGTTTGACAGGCCCGTCCGGCCCGAAGAGCTGCTGGGCGTGTCGCCTTATCACGTCGCACTAG
ACCCCGACTCTGCATGGACATCGTTCTTTCACTCGAGATCCTGCAAGCTAGTCGCCATTCCTCGTTTCCAGGATT
CTCCCGGCGATGCCAGTCGCTCCACATCAACATTTTCTTTGAAGAGAATCCTCCCTGGAGGAGGCAGACGGAATC
CGCCGCCGCATCTGGTCAAGCCGAGGATGCTATCCTCTTCGCCGGGCTCAGGACCAAGCCCCTCTTCTGCCTACA
CCGCTCCTGGCCGAACCCCCAAGCCTCTTCAAGACTTTCCCGCCTCGGACGAGGCCACTCCTCCGACACGGACGA
TACGATCGCTGTCTGCCAGTCTCTCTTCGGCCAGTAGTTGGGTCTCGAAACGATCCGGCAGTCTCCGCCGATCCA
AGAAAGGCTCTGATCGAAGAGGCGGCAAATCCAGACCGCACGAATCCGAGCCACCAGAAAGCACCGCTTGCCATT
CCCCAGCCCATCAGCAAGGTCTTCGCTCGTCGTCTGAGGACCCCAGCGAGTTGTCGGTGGCCTCCAAGATGCATC
GGCAGCGGGTGCCGGGACCCTTGAACCAGACTCTCCACGGTCGGCTGCCCATGTGCGATGAGAAGGCGTCTTTCC
CAGAAGCTCCTCTATCGTCCAGTCATTCTGGTTTGGGTCGTGGGGGTAACGACTTCTCACGCTCAGCCGGTCGCC
CCCATGGCACCATGACTCGCCAAATTCGACCCAACCATGCGTCGGGAAGCTCGACGAGTTCCACCGTCATGTCCC
AGTTGGCCAGAGTGTCACTCCACGAGCGGTCCCCTGTCATGGAGGGCTCCGACGGCGAGGCTCGGGGATTCACTT
CCGGGGACGACGATGACACCGACCTCAAGAGTGACACCGTCTTCGACTCGCTGCGAACGCTCGCCTCGTCGCGTG
CGAGGGTTGTCGAGACGCCTCTCGAGTCTGTATACGACGAGTCTCCCCCAAGCACAGCCGGCAAGACGACACGAC
TTTCTGTGCAGGAGATGCTGGGAGCAAGCTGGGAGGAAGGGAATCGGATCACGGAAGAAGACGACGAGAACCACT
TGGCCCCGTCTCAGCATGGCGGTGTCGGCTTTTGCAAAGCTGGACCTGCCATGTTCATCACTATGCCTCGCTTTG
GAGCAGCTTCGTCACCAACGAGGACTGGAAACTCTCCGCTGGAGGCCGTCATGAACGATTGTGATGGTGAAGACG
AAGACTGGACGAGGGATGACGACATGTCTTTCAGTAACTCGCTCTCAGCTCACCCCGAGAAACCTTTGGCTGGTC
TTGGAGGAATGAACCCCAAGGTCCAGATTGCCCTGCCAGGCGCCCAGACGAAGACGGCTGCCGAGCGGCCCCTTA
GCAACCTCTTTGATTGGAGCGAGCCCCCGACGCACGGCAAGCACGAGAGCGACGGCGGTTCTCTGCGGCCGCGGA
CGGCGTATGTCATCCCGCTGGTGGACTCTAGGGGAGGTCGCACAGCGGTCCGCAAGGGGCCGATGCCGACACACG
TGCGAAGCCAGAGCGTCCCCGTCGTTCATGACCCTCCCGAGGAGTCGAAGCCGGCCGGGCCAAAGTACGGCACCT
GGGGTCTGGGAACTAAGACCGTCTCGGAGGATTGGGACGAGGACTTTGAGTTTGGGGCCGCGAGCGGAGACGGCA
AGGACGAGGCCAACGGTAAGAGCCGCGAGAACGTCTTTGCCGTGCCCGAGTCGATCCGGGCCACGCAGCCCAGCG
TCAGAGCGCACTCGGGCCAGATCCGCGAGCTATCTCTCCTGGTCAACGACTTGAAGCGCCTGTTTCGTCACGGGC
GTGAGCTCGACATGCTCGACGGCGAGCAGACGGGCCTGTGGAGGGAGGCCGAGGGCATCATCACGCTGGCCTCGC
CCGACGAGGACGACGCGGGTCACGACGGTCAGACGGAGGCCAAGAATGACCGCGAACCGGATCAGTGGGGCGGTT
CCAAGGACAGCTCGGAGCCGAGCAAGTGGAGGACGGCGGTGGTGCGTGAGCGTCAGTCGCCGAGGCGGCGGTCCG
TCTTCTCGTCGGAAGACGACATCTTTGGCACCAGCTGGCCAGTTTCCGAGGAGAGCAGCCGGCAGTCGGACGACA
AAGGGGCCAGCGACGTCAGCGGAGTGGTGCGCTGCGTCATGGAATCGCTACGAAAGCCGCAGCGCGGGGCGGCTC
GGCTGGCACGGAGCAACGATGTCTGCAACGGCAGGGTGCAGTTCGACACCAATAACCTCAAGGAGCTGGTCAAGA
GGGCCGGGGAGTTACGGGACGCTCTGTCCGACATGATTCGCAAGGCCGACTGGATGACGCAGAGCCCGATGGCTA
CTCCGCGACACGAGTGCCGGCTCGACTCGAGTCCCGCCTTCACCCGGGTCTTTGACGATCCCTGCTCGACCCCCC
CGCGGCGGACGACTCGGACCCGTGGCAGCAACTCGCTCATGGACGAGGTTTCGTCTCCGAACAAGTCTCCATCGT
CACCCATGGGACCGCAGGCGGCGGTCATGACGGTCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail