Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01469
Gene name
Locationscaffold_01:5086921..5088785
Strand+
Gene length (bp)1864
Transcript length (bp)1755
Coding sequence length (bp)1755
Protein length (aa) 585

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01564 Spermine_synth Spermine/spermidine synthase domain 6.4E-07 342 448

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 86 108 22
3 115 137 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 111.71 61.82 161.60
Alive In ants, during behavior modification 116.03 60.60 171.46
Dead In ants, recently dead 116.14 63.63 168.65

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.883915 no
Alive Dead 0.996386 no
Dead Fungus 0.873867 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01469
MPAKTASKAPAPAPAPADGFTPERFEAELKDLAAKARDDSSGKRVVEQLFLFAKAALLLALLGVYSFVSPLYLSP
VYGSLPASSWHSQLLMVGCFIGWAGNVAFRNLLPVRTTKLLPLVALYIPTVQWFLVGYSSLLGPRWGPLVTEGVT
LMPLAVLTAASVADLFEDARLPLLPGFIAEAAPGIGSWAWLKFVELLAGRHLPPNMGRLIPLTRLGMELMLGAVY
AVLDRSKILVYVLPPLMHTMVFNTHLASPASTSRLVSSMLSDNWLLLERRESLTGYVSVVQSLERRFRAMRCDHS
ILGGDWINERGRALSEPIYGVFVMLEAVRLAERDDPPPDKEARALVVGLGVGTTPSTLVTHGINTTVVEIDPVVY
EFAVKYFDLKENNAPVLEDAVSYTSSLSATAPQSYDYIIHDVFTGGAEPVQLFTLEFLQSLEKLLKPNGVIAINY
AGDLALPPPAIIMRTIKRVFPTCRVFREVPPDAKAMELDGADFANMAIFCTKSSSPLTFRSPTPADHLESETRKM
FLTLEHEMLESEILSRHQDDATVLLRNDTSAVEKWHEQGALGHWAIMRRMLPASVWERW*
Coding >Ophcf2|01469
ATGCCGGCGAAAACAGCGAGCAAGGCGCCGGCTCCGGCTCCGGCTCCGGCTGACGGCTTCACCCCCGAACGCTTC
GAAGCTGAGCTCAAGGACCTCGCCGCCAAGGCCAGGGATGATTCTTCGGGAAAACGCGTCGTCGAGCAGTTGTTT
CTTTTCGCAAAGGCGGCTCTCCTGCTGGCCCTCCTCGGCGTCTACTCCTTCGTCTCGCCCCTCTATCTATCGCCT
GTATACGGTTCGCTGCCGGCCTCGTCATGGCATTCTCAGCTTCTCATGGTTGGCTGCTTCATCGGATGGGCGGGA
AACGTGGCCTTTCGAAATCTGCTCCCCGTCAGGACGACGAAACTACTGCCGCTCGTCGCTCTCTACATACCGACG
GTGCAATGGTTTCTCGTCGGCTATAGCAGTCTTCTTGGTCCCCGGTGGGGTCCCCTTGTCACCGAGGGCGTTACC
TTGATGCCCCTCGCTGTCTTGACTGCCGCTTCCGTCGCCGACCTCTTTGAGGATGCGCGACTACCTCTTCTTCCG
GGGTTCATCGCCGAGGCCGCCCCGGGGATCGGTTCATGGGCCTGGCTCAAGTTTGTCGAGCTGCTGGCCGGCCGC
CATCTGCCGCCCAACATGGGCCGTCTCATCCCTCTCACCCGCCTCGGCATGGAACTGATGCTGGGCGCCGTGTAC
GCCGTCCTTGATCGGTCCAAGATTCTTGTCTATGTGCTGCCTCCGTTGATGCACACCATGGTTTTCAACACACAC
CTCGCCTCGCCGGCCTCCACCTCGCGGCTCGTCAGCTCCATGCTCTCAGACAATTGGCTGCTGCTGGAGCGTCGA
GAGTCTCTGACGGGGTACGTTTCCGTTGTGCAGAGCTTGGAACGACGCTTCCGCGCCATGCGCTGTGATCACAGC
ATCTTGGGCGGCGACTGGATCAACGAGCGTGGCCGGGCGTTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTT
GAGGCTGTGCGACTGGCCGAGAGGGACGACCCGCCGCCCGACAAGGAGGCACGCGCTCTGGTTGTTGGGCTCGGC
GTGGGTACGACGCCCTCGACTCTCGTCACCCACGGCATCAATACGACTGTTGTCGAGATCGACCCGGTCGTGTAC
GAGTTTGCCGTCAAGTACTTTGATCTCAAGGAGAACAATGCTCCCGTCTTGGAGGATGCCGTGAGCTACACCTCG
TCTCTATCGGCAACCGCCCCTCAAAGTTACGACTACATCATTCATGACGTCTTTACCGGCGGCGCCGAACCCGTG
CAGCTCTTTACTCTAGAGTTTCTCCAGAGCCTGGAGAAGCTGCTGAAGCCCAATGGAGTCATTGCCATTAACTAC
GCCGGCGATCTCGCCCTCCCCCCTCCTGCCATCATCATGCGCACCATCAAGCGCGTCTTTCCGACATGTCGCGTC
TTCCGCGAGGTGCCCCCTGACGCGAAGGCCATGGAGCTAGACGGAGCCGACTTTGCCAACATGGCCATCTTCTGC
ACAAAGTCCAGCTCTCCGCTGACTTTTAGGAGCCCTACGCCGGCCGACCATCTCGAGAGCGAGACGAGAAAGATG
TTTCTCACCCTGGAGCACGAGATGCTCGAGTCTGAGATTCTGTCCCGGCATCAAGACGATGCGACTGTCTTGCTG
AGGAACGATACCAGCGCGGTGGAGAAATGGCATGAGCAGGGAGCGCTGGGTCACTGGGCTATAATGCGAAGGATG
CTGCCGGCTTCTGTGTGGGAGCGGTGGTGA
Transcript >Ophcf2|01469
ATGCCGGCGAAAACAGCGAGCAAGGCGCCGGCTCCGGCTCCGGCTCCGGCTGACGGCTTCACCCCCGAACGCTTC
GAAGCTGAGCTCAAGGACCTCGCCGCCAAGGCCAGGGATGATTCTTCGGGAAAACGCGTCGTCGAGCAGTTGTTT
CTTTTCGCAAAGGCGGCTCTCCTGCTGGCCCTCCTCGGCGTCTACTCCTTCGTCTCGCCCCTCTATCTATCGCCT
GTATACGGTTCGCTGCCGGCCTCGTCATGGCATTCTCAGCTTCTCATGGTTGGCTGCTTCATCGGATGGGCGGGA
AACGTGGCCTTTCGAAATCTGCTCCCCGTCAGGACGACGAAACTACTGCCGCTCGTCGCTCTCTACATACCGACG
GTGCAATGGTTTCTCGTCGGCTATAGCAGTCTTCTTGGTCCCCGGTGGGGTCCCCTTGTCACCGAGGGCGTTACC
TTGATGCCCCTCGCTGTCTTGACTGCCGCTTCCGTCGCCGACCTCTTTGAGGATGCGCGACTACCTCTTCTTCCG
GGGTTCATCGCCGAGGCCGCCCCGGGGATCGGTTCATGGGCCTGGCTCAAGTTTGTCGAGCTGCTGGCCGGCCGC
CATCTGCCGCCCAACATGGGCCGTCTCATCCCTCTCACCCGCCTCGGCATGGAACTGATGCTGGGCGCCGTGTAC
GCCGTCCTTGATCGGTCCAAGATTCTTGTCTATGTGCTGCCTCCGTTGATGCACACCATGGTTTTCAACACACAC
CTCGCCTCGCCGGCCTCCACCTCGCGGCTCGTCAGCTCCATGCTCTCAGACAATTGGCTGCTGCTGGAGCGTCGA
GAGTCTCTGACGGGGTACGTTTCCGTTGTGCAGAGCTTGGAACGACGCTTCCGCGCCATGCGCTGTGATCACAGC
ATCTTGGGCGGCGACTGGATCAACGAGCGTGGCCGGGCGTTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTT
GAGGCTGTGCGACTGGCCGAGAGGGACGACCCGCCGCCCGACAAGGAGGCACGCGCTCTGGTTGTTGGGCTCGGC
GTGGGTACGACGCCCTCGACTCTCGTCACCCACGGCATCAATACGACTGTTGTCGAGATCGACCCGGTCGTGTAC
GAGTTTGCCGTCAAGTACTTTGATCTCAAGGAGAACAATGCTCCCGTCTTGGAGGATGCCGTGAGCTACACCTCG
TCTCTATCGGCAACCGCCCCTCAAAGTTACGACTACATCATTCATGACGTCTTTACCGGCGGCGCCGAACCCGTG
CAGCTCTTTACTCTAGAGTTTCTCCAGAGCCTGGAGAAGCTGCTGAAGCCCAATGGAGTCATTGCCATTAACTAC
GCCGGCGATCTCGCCCTCCCCCCTCCTGCCATCATCATGCGCACCATCAAGCGCGTCTTTCCGACATGTCGCGTC
TTCCGCGAGGTGCCCCCTGACGCGAAGGCCATGGAGCTAGACGGAGCCGACTTTGCCAACATGGCCATCTTCTGC
ACAAAGTCCAGCTCTCCGCTGACTTTTAGGAGCCCTACGCCGGCCGACCATCTCGAGAGCGAGACGAGAAAGATG
TTTCTCACCCTGGAGCACGAGATGCTCGAGTCTGAGATTCTGTCCCGGCATCAAGACGATGCGACTGTCTTGCTG
AGGAACGATACCAGCGCGGTGGAGAAATGGCATGAGCAGGGAGCGCTGGGTCACTGGGCTATAATGCGAAGGATG
CTGCCGGCTTCTGTGTGGGAGCGGTGGTGA
Gene >Ophcf2|01469
ATGCCGGCGAAAACAGCGAGCAAGGCGCCGGCTCCGGCTCCGGCTCCGGCTGACGGCTTCACCCCCGAACGCTTC
GAAGCTGAGCTCAAGGACCTCGCCGCCAAGGCCAGGGATGATTCTTCGGGAAAACGCGTCGTCGAGCAGTTGTTT
CTTTTCGCAAAGGCGGCTCTCCTGCTGGCCCTCCTCGGCGTCTACTCCTTCGTCTCGCCCCTCTATCTATCGCCT
GTATACGGTTCGCTGCCGGCCTCGTCATGGCATTCTCAGCTTCTCATGGTTGGCTGCTTCATCGGATGGGCGGGA
AACGTGGCCTTTCGAAATCTGCTCCCCGTCAGGACGACGAAACTACTGCCGCTCGTCGCTCTCTACATACCGACG
GTGCAATGGTTTCTCGTCGGCTATAGCAGTCTTCTTGGTCCCCGGTGGGGTCCCCTTGTCACCGAGGGCGTTACC
TTGATGCCCCTCGCTGTCTTGACTGCCGCTTCCGTCGCCGACCTCTTTGAGGATGCGCGACTACCTCTTCTTCCG
GGGTTCATCGCCGAGGCCGCCCCGGGGATCGGTTCATGGGCCTGGCTCAAGTTTGTCGAGCTGCTGGCCGGCCGC
CATCTGCCGCCCAACATGGGCCGTCTCATCCCTCTCACCCGCCTCGGCATGGAACTGATGCTGGGCGCCGTGTAC
GCCGTCCTTGATCGGTCCAAGATTCTTGTCTATGTGCTGCCTCCGTTGATGCACACCATGGTTTTCAACACACAC
CTCGCCTCGCCGGCCTCCACCTCGCGGCTCGTCAGCTCCATGCTCTCAGACAATTGGCTGCTGCTGGAGCGTCGA
GAGTCTCTGACGGGGTACGTTTCCGTTGTGCAGAGCTTGGAACGACGCTTCCGCGCCATGCGCTGTGATCACAGC
ATCTTGGGCGGCGACTGGATCAACGAGCGTGGCCGGGCGTTGTCGGAGCCCATCTACGGCGTCTTCGTCATGCTT
GAGGCTGTGCGACTGGCCGAGAGGGACGACCCGCCGCCCGACAAGGAGGCACGCGCTCTGGTTGTGTAAGTTTCG
GCCCTGACTCTTGAAAACTGGTGTCGGTGCTGACGGGACACAGTGGGCTCGGCGTGGGTACGACGCCCTCGACTC
TCGTCACCCACGGCATCAATACGACTGTTGTCGAGATCGACCCGGTCGTGTACGAGTTTGCCGTCAAGTACTTTG
ATCTCAAGGAGAACAATGCTCCCGTCTTGGAGGATGCCGTGAGCTACACCTCGTCTCTATCGGCAACCGCCCCTC
AAAGTTACGACTACATCATTCATGACGTCTTTACCGGCGGCGCCGAACCCGTGCAGCTCTTTACTCTAGAGTTTC
TCCAGAGCCTGGAGAAGCTGCTGAAGCCCAATGGAGTCATTGCCATTGTGAGTGGCCTGTCGGTGAGCGAGCTCG
GATACCGGAGTCTAACGCTTGTCTGCAGAACTACGCCGGCGATCTCGCCCTCCCCCCTCCTGCCATCATCATGCG
CACCATCAAGCGCGTCTTTCCGACATGTCGCGTCTTCCGCGAGGTGCCCCCTGACGCGAAGGCCATGGAGCTAGA
CGGAGCCGACTTTGCCAACATGGCCATCTTCTGCACAAAGTCCAGCTCTCCGCTGACTTTTAGGAGCCCTACGCC
GGCCGACCATCTCGAGAGCGAGACGAGAAAGATGTTTCTCACCCTGGAGCACGAGATGCTCGAGTCTGAGATTCT
GTCCCGGCATCAAGACGATGCGACTGTCTTGCTGAGGAACGATACCAGCGCGGTGGAGAAATGGCATGAGCAGGG
AGCGCTGGGTCACTGGGCTATAATGCGAAGGATGCTGCCGGCTTCTGTGTGGGAGCGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail