Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01466
Gene name
Locationscaffold_01:5075110..5077737
Strand+
Gene length (bp)2627
Transcript length (bp)2406
Coding sequence length (bp)2406
Protein length (aa) 802

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09329 zf-primase Primase zinc finger 3.8E-15 446 491

GO

GO Term Description Terminal node
GO:0006260 DNA replication Yes
GO:0005634 nucleus Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0043227 membrane-bounded organelle No
GO:0046483 heterocycle metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005575 cellular_component No
GO:0006807 nitrogen compound metabolic process No
GO:0043229 intracellular organelle No
GO:0090304 nucleic acid metabolic process No
GO:0008150 biological_process No
GO:0043226 organelle No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 742 764 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01466
MAPVPDPEPRWPPRSPRDALLSTPSGRRRYRESLEQTSPSPSPVKRSVPLGNTRIDPDDEDEDEETLQLKLQEIQ
ARLRLKKLQSAKSREDSGLGQSIGPEPPRQTIMPPAQIGSNSTPRSAPTRPQVLVPASPVRKAQPLQPQKSPGRA
MDKELAAQGASLKRASSQRGSTQHTTTQGRIYTHPVASSSLSSQTEKVPTFNERLALSRNEEAVRSQKQTRVQSS
RSKAFGIGQQEMEEYKKNAVQIPDDETAEGSTFTGHEVLSQGKPGAANLSRSMTTPSLSQDASESNSLSQQPAQA
SFEPYSCFHLSRRILPHRVLARHVSGKKQFNLKDVLKKVKAPDYSLPDVEQDIVVFAILAKKSEPRSHNKAAGDR
GKYMVMTIVDLKFEMELFLFNSGFTRFWKLTEGTVLAILNPTVMPPPPGRQDSGRFSLVIDSDADTILEIGAARD
LDFCKEVKKDGHMCGSWVNQKRSHICEFHSNEAIRKRRAQRMEMNSSSFGAYQPKSRELSIGKRKNKNYDAETKS
RWFASQSHSAADLLDGRTLGPADKKERQEFLKRSLEAKEREREMMRQLGRVGNAAGKEYMQSAGRRTTDGGEAPT
AKGRTTDEAAIYRGKDGARHLSPIKRKRPQSSSASSSSLASGMKRSSGYGWGSTLKEKLSKMREGNEGKSPTRKK
TRFVTDRGIREAGRESLGREAAARPAEDEDEDELVIVGYDVYNGRHVAGRSKMTDMAMTGMNKVVEVVVVEVVMV
VVVVAMMMMMVVLVSRSWPEPWEFQVANESVSQFVMVTTRQGPDPTDEEPP*
Coding >Ophcf2|01466
ATGGCTCCAGTTCCAGATCCCGAGCCCCGCTGGCCGCCGCGGTCGCCCCGTGATGCATTGCTGAGCACGCCATCT
GGGCGACGCCGATACCGAGAGTCTCTGGAGCAGACCTCGCCGTCGCCTTCTCCTGTAAAGCGCTCGGTGCCTCTC
GGCAATACCCGAATTGACCCAGACGATGAGGACGAAGACGAGGAGACGCTGCAGCTGAAGCTGCAAGAGATACAG
GCTCGACTGCGGCTGAAGAAGTTGCAGAGCGCAAAGAGCAGGGAGGACAGTGGGCTGGGCCAGAGCATCGGCCCA
GAACCTCCGCGGCAGACGATAATGCCGCCCGCCCAAATTGGTTCCAATAGTACTCCGCGTTCCGCTCCTACTCGT
CCCCAGGTTCTGGTCCCTGCGTCTCCAGTCCGCAAGGCTCAGCCCCTCCAGCCGCAAAAATCTCCCGGCCGGGCC
ATGGACAAGGAGCTTGCAGCTCAGGGCGCATCTCTCAAACGAGCATCGTCTCAGAGGGGCAGTACGCAGCATACC
ACCACACAGGGTAGGATTTACACGCACCCTGTCGCATCGTCGTCACTCTCGTCGCAGACGGAAAAAGTACCGACC
TTCAACGAAAGGCTAGCCTTGTCGAGAAATGAGGAAGCCGTGCGAAGTCAGAAGCAGACGAGGGTGCAAAGCTCG
AGGTCGAAAGCCTTTGGCATCGGCCAGCAGGAGATGGAGGAGTACAAGAAGAATGCCGTCCAGATTCCTGACGAT
GAGACGGCAGAGGGTTCCACGTTCACCGGCCACGAGGTTTTGTCTCAAGGGAAGCCCGGGGCTGCCAACCTTTCG
AGAAGTATGACGACGCCGAGCCTATCTCAAGACGCAAGCGAATCAAACTCATTATCCCAACAACCGGCGCAGGCG
TCCTTTGAGCCCTACTCGTGCTTCCACCTGTCGCGTCGTATCCTGCCTCATCGTGTGCTCGCACGACACGTCTCC
GGAAAGAAGCAGTTCAACCTCAAAGATGTCCTCAAAAAGGTCAAGGCGCCCGATTACTCTTTGCCCGATGTCGAG
CAGGATATCGTCGTCTTCGCCATCCTGGCCAAGAAATCGGAACCTCGCAGTCACAACAAGGCTGCCGGAGACCGT
GGGAAATACATGGTCATGACCATTGTTGACCTCAAGTTCGAGATGGAGCTGTTCCTGTTCAACTCTGGCTTTACG
AGATTTTGGAAGCTGACAGAGGGAACGGTGCTGGCCATCCTCAACCCTACCGTCATGCCTCCTCCACCCGGACGG
CAGGACAGTGGACGCTTCAGCCTCGTCATCGACTCGGACGCCGATACGATACTGGAGATTGGGGCAGCACGCGAC
CTGGACTTTTGCAAGGAGGTCAAGAAGGATGGTCACATGTGCGGCTCTTGGGTGAATCAGAAGAGGAGTCACATT
TGCGAGTTTCACTCCAACGAGGCCATCCGCAAGAGACGGGCTCAGCGAATGGAGATGAACTCGAGCAGCTTCGGC
GCGTACCAGCCCAAGTCAAGAGAGCTGTCTATTGGCAAGAGAAAGAACAAAAACTACGACGCGGAGACGAAGTCG
AGGTGGTTCGCTTCTCAGTCGCATAGCGCAGCAGACCTCCTCGACGGAAGGACCCTAGGGCCGGCTGATAAGAAA
GAGAGACAAGAGTTCCTCAAGAGGAGTCTAGAAGCCAAGGAAAGGGAGCGTGAGATGATGAGACAGCTCGGTCGG
GTGGGCAATGCAGCCGGCAAGGAATACATGCAGAGCGCCGGCCGGCGGACGACGGACGGCGGTGAGGCGCCAACG
GCCAAGGGCAGGACGACGGATGAGGCGGCAATTTACAGAGGCAAGGATGGGGCGAGGCATCTAAGCCCGATCAAG
CGCAAGCGACCGCAGAGCTCTTCGGCTAGCTCGAGCTCGCTGGCCAGTGGGATGAAACGGTCTTCGGGCTATGGA
TGGGGAAGCACTCTGAAGGAGAAGCTGAGCAAGATGAGGGAGGGAAATGAGGGCAAGTCGCCGACGCGCAAGAAG
ACGAGGTTCGTGACGGACAGAGGGATCCGCGAGGCAGGACGGGAGAGCCTTGGCAGGGAGGCAGCGGCTCGGCCG
GCAGAGGATGAGGACGAGGATGAATTGGTCATTGTCGGATACGACGTCTATAACGGGCGACACGTGGCGGGCCGA
AGCAAGATGACGGACATGGCGATGACGGGCATGAACAAAGTTGTGGAGGTGGTGGTGGTGGAGGTGGTGATGGTG
GTGGTGGTGGTGGCGATGATGATGATGATGGTGGTTCTTGTCAGCCGGAGCTGGCCGGAGCCGTGGGAGTTTCAG
GTGGCCAACGAGTCGGTGAGCCAGTTCGTCATGGTGACGACGAGGCAAGGCCCAGATCCGACCGACGAGGAGCCG
CCGTGA
Transcript >Ophcf2|01466
ATGGCTCCAGTTCCAGATCCCGAGCCCCGCTGGCCGCCGCGGTCGCCCCGTGATGCATTGCTGAGCACGCCATCT
GGGCGACGCCGATACCGAGAGTCTCTGGAGCAGACCTCGCCGTCGCCTTCTCCTGTAAAGCGCTCGGTGCCTCTC
GGCAATACCCGAATTGACCCAGACGATGAGGACGAAGACGAGGAGACGCTGCAGCTGAAGCTGCAAGAGATACAG
GCTCGACTGCGGCTGAAGAAGTTGCAGAGCGCAAAGAGCAGGGAGGACAGTGGGCTGGGCCAGAGCATCGGCCCA
GAACCTCCGCGGCAGACGATAATGCCGCCCGCCCAAATTGGTTCCAATAGTACTCCGCGTTCCGCTCCTACTCGT
CCCCAGGTTCTGGTCCCTGCGTCTCCAGTCCGCAAGGCTCAGCCCCTCCAGCCGCAAAAATCTCCCGGCCGGGCC
ATGGACAAGGAGCTTGCAGCTCAGGGCGCATCTCTCAAACGAGCATCGTCTCAGAGGGGCAGTACGCAGCATACC
ACCACACAGGGTAGGATTTACACGCACCCTGTCGCATCGTCGTCACTCTCGTCGCAGACGGAAAAAGTACCGACC
TTCAACGAAAGGCTAGCCTTGTCGAGAAATGAGGAAGCCGTGCGAAGTCAGAAGCAGACGAGGGTGCAAAGCTCG
AGGTCGAAAGCCTTTGGCATCGGCCAGCAGGAGATGGAGGAGTACAAGAAGAATGCCGTCCAGATTCCTGACGAT
GAGACGGCAGAGGGTTCCACGTTCACCGGCCACGAGGTTTTGTCTCAAGGGAAGCCCGGGGCTGCCAACCTTTCG
AGAAGTATGACGACGCCGAGCCTATCTCAAGACGCAAGCGAATCAAACTCATTATCCCAACAACCGGCGCAGGCG
TCCTTTGAGCCCTACTCGTGCTTCCACCTGTCGCGTCGTATCCTGCCTCATCGTGTGCTCGCACGACACGTCTCC
GGAAAGAAGCAGTTCAACCTCAAAGATGTCCTCAAAAAGGTCAAGGCGCCCGATTACTCTTTGCCCGATGTCGAG
CAGGATATCGTCGTCTTCGCCATCCTGGCCAAGAAATCGGAACCTCGCAGTCACAACAAGGCTGCCGGAGACCGT
GGGAAATACATGGTCATGACCATTGTTGACCTCAAGTTCGAGATGGAGCTGTTCCTGTTCAACTCTGGCTTTACG
AGATTTTGGAAGCTGACAGAGGGAACGGTGCTGGCCATCCTCAACCCTACCGTCATGCCTCCTCCACCCGGACGG
CAGGACAGTGGACGCTTCAGCCTCGTCATCGACTCGGACGCCGATACGATACTGGAGATTGGGGCAGCACGCGAC
CTGGACTTTTGCAAGGAGGTCAAGAAGGATGGTCACATGTGCGGCTCTTGGGTGAATCAGAAGAGGAGTCACATT
TGCGAGTTTCACTCCAACGAGGCCATCCGCAAGAGACGGGCTCAGCGAATGGAGATGAACTCGAGCAGCTTCGGC
GCGTACCAGCCCAAGTCAAGAGAGCTGTCTATTGGCAAGAGAAAGAACAAAAACTACGACGCGGAGACGAAGTCG
AGGTGGTTCGCTTCTCAGTCGCATAGCGCAGCAGACCTCCTCGACGGAAGGACCCTAGGGCCGGCTGATAAGAAA
GAGAGACAAGAGTTCCTCAAGAGGAGTCTAGAAGCCAAGGAAAGGGAGCGTGAGATGATGAGACAGCTCGGTCGG
GTGGGCAATGCAGCCGGCAAGGAATACATGCAGAGCGCCGGCCGGCGGACGACGGACGGCGGTGAGGCGCCAACG
GCCAAGGGCAGGACGACGGATGAGGCGGCAATTTACAGAGGCAAGGATGGGGCGAGGCATCTAAGCCCGATCAAG
CGCAAGCGACCGCAGAGCTCTTCGGCTAGCTCGAGCTCGCTGGCCAGTGGGATGAAACGGTCTTCGGGCTATGGA
TGGGGAAGCACTCTGAAGGAGAAGCTGAGCAAGATGAGGGAGGGAAATGAGGGCAAGTCGCCGACGCGCAAGAAG
ACGAGGTTCGTGACGGACAGAGGGATCCGCGAGGCAGGACGGGAGAGCCTTGGCAGGGAGGCAGCGGCTCGGCCG
GCAGAGGATGAGGACGAGGATGAATTGGTCATTGTCGGATACGACGTCTATAACGGGCGACACGTGGCGGGCCGA
AGCAAGATGACGGACATGGCGATGACGGGCATGAACAAAGTTGTGGAGGTGGTGGTGGTGGAGGTGGTGATGGTG
GTGGTGGTGGTGGCGATGATGATGATGATGGTGGTTCTTGTCAGCCGGAGCTGGCCGGAGCCGTGGGAGTTTCAG
GTGGCCAACGAGTCGGTGAGCCAGTTCGTCATGGTGACGACGAGGCAAGGCCCAGATCCGACCGACGAGGAGCCG
CCGTGA
Gene >Ophcf2|01466
ATGGCTCCAGGTAAGGAGGCCTCGTCCGCATTTCGGGTCCGAGCACTGCAGAAAAGCTGATGATGCGATGCCGCG
CAGTTCCAGATCCCGAGCCCCGCTGGCCGCCGCGGTCGCCCCGTGATGCATTGCTGAGCACGCCATCTGGGCGAC
GCCGATACCGAGAGTCTCTGGAGCAGACCTCGCCGTCGCCTTCTCCTGTAAAGCGCTCGGTGCCTCTCGGCAATA
CCCGAATTGACCCAGACGATGAGGACGAAGACGAGGAGACGCTGCAGCTGAAGCTGCAAGAGATACAGGCTCGAC
TGCGGCTGAAGAAGTTGCAGAGCGCAAAGAGCAGGGAGGACAGTGGGCTGGGCCAGAGCATCGGCCCAGAACCTC
CGCGGCAGACGATAATGCCGCCCGCCCAAATTGGTTCCAATAGTACTCCGCGTTCCGCTCCTACTCGTCCCCAGG
TTCTGGTCCCTGCGTCTCCAGTCCGCAAGGCTCAGCCCCTCCAGCCGCAAAAATCTCCCGGCCGGGCCATGGACA
AGGAGCTTGCAGCTCAGGGCGCATCTCTCAAACGAGCATCGTCTCAGAGGGGCAGTACGCAGCATACCACCACAC
AGGGTAGGATTTACACGCACCCTGTCGCATCGTCGTCACTCTCGTCGCAGACGGAAAAAGTACCGACCTTCAACG
AAAGGCTAGCCTTGTCGAGAAATGAGGAAGCCGTGCGAAGTCAGAAGCAGACGAGGGTGCAAAGCTCGAGGTCGA
AAGCCTTTGGCATCGGCCAGCAGGAGATGGAGGAGTACAAGAAGAATGCCGTCCAGATTCCTGACGATGAGACGG
CAGAGGGTTCCACGTTCACCGGCCACGAGGTTTTGTCTCAAGGGAAGCCCGGGGCTGCCAACCTTTCGAGAAGTA
TGACGACGCCGAGCCTATCTCAAGACGCAAGCGAATCAAACTCATTATCCCAACAACCGGCGCAGGCGTCCTTTG
AGCCCTACTCGTGCTTCCACCTGTCGCGTCGTATCCTGCCTCATCGTGTGCTCGCACGACACGTCTCCGGAAAGA
AGCAGTTCAACCTCAAAGATGTCCTCAAAAAGGTCAAGGCGCCCGATTACTCTTTGCCCGATGTCGAGCAGGATA
TCGTCGTCTTCGCCATCCTGGCCAAGAAATCGGAACCTCGCAGTCACAACAAGGCTGCCGGAGACCGTGGGAAAT
ACATGGTCATGACCATTGTTGACCTCAAGTTCGAGATGGAGCTGTTCCTGTTCAACTCTGGCTTTACGAGATTTT
GGAAGCTGACAGAGGGAACGGTGCTGGCCATCCTCAACCCTACCGTCATGCCTCCTCCACCCGGACGGCAGGACA
GTGGACGCTTCAGCCTCGTCATCGACTCGGACGCCGATACGATACTGGAGATTGGGGCAGCACGCGACCTGGACT
TTTGCAAGGAGGTCAAGAAGGATGGTCACATGTGCGGCTCTTGGGTGAATCAGAAGAGGAGTCACATTTGCGAGT
TTCACTCCAACGAGGCCATCCGCAAGAGACGGGCTCAGCGAATGGAGATGAACTCGAGCAGCTTCGGCGCGTACC
AGCCCAAGTCAAGAGAGCTGTCTATTGGCAAGAGAAAGAACAAAAACTACGACGCGGAGACGAAGTCGAGGTGGT
TCGCTTCTCAGTCGCATAGCGCAGCAGACCTCCTCGACGGAAGGACCCTAGGGCCGGCTGATAAGAAAGAGAGAC
AAGAGTTCCTCAAGAGGAGTCTAGAAGCCAAGGAAAGGGAGCGTGAGATGATGAGACAGCTCGGTCGGGTGGGCA
ATGCAGCCGGCAAGGAATACATGCAGAGCGCCGGCCGGCGGACGACGGACGGCGGTGAGGCGCCAACGGCCAAGG
GCAGGACGACGGATGAGGCGGCAATTTACAGAGGCAAGGATGGGGCGAGGCATCTAAGCCCGATCAAGCGCAAGC
GACCGCAGAGCTCTTCGGCTAGCTCGAGCTCGCTGGCCAGTGGGATGAAACGGTCTTCGGGCTATGGATGGGGAA
GCACTCTGAAGGAGAAGCTGAGCAAGATGAGGGAGGGAAATGAGGGCAAGTCGCCGACGCGCAAGAAGACGAGGT
TCGTGACGGACAGAGGGATCCGCGAGGCAGGACGGGAGAGCCTTGGCAGGGAGGCAGCGGCTCGGCCGGCAGAGG
ATGAGGACGAGGATGAATTGGTCATTGTCGGGTAAGGAATGAATTGACGGGCCGGGATGCAGGCAGACCAGAAGG
TCCCGGGGATCATCGGGCGTGCGACGATGAGGGCCGACATATTCGTACAGATACGACGTCTATAACGGGCGACAC
GTGGCGGGCCGAAGCAAGATGACGGACATGGCGATGACGGGCATGAACAAAGTTGTGGAGGTGGTGGTGGTGGAG
GTGGTGATGGTGGTGGTGGTGGTGGCGATGATGATGATGATGGTGGTTCTTGTCAGCCGGAGCTGGCCGGAGCCG
TGGGAGTTTCAGGTGGCCAACGAGTCGGTGAGCCAGTTGTCAGTGTCTCATATGCCGTGTAACGCAGAACCAGGC
GACTGACAAGAGGGCCATGAAGCGTCATGGTGACGACGAGGCAAGGCCCAGATCCGACCGACGAGGAGCCGCCGT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail