Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01465
Gene name
Locationscaffold_01:5073447..5074659
Strand-
Gene length (bp)1212
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain 1.7E-45 141 310
PF17745 Ydr279_N Ydr279p protein triple barrel domain 1.1E-18 49 138

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3406 0.8761 0.0702 0.0151 0.1311 0.0064 0.0339 0.0101 0.026 0.0035

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 63.69 35.90 91.47
Alive In ants, during behavior modification 126.40 69.85 182.94
Dead In ants, recently dead 87.26 49.04 125.48

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.019699 yes
Dead Fungus 0.095668 no

Orthologs

Orthofinder run ID4
Orthogroup3329
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6458
Ophiocordyceps australis map64 (Brazil) OphauB2|2554
Ophiocordyceps camponoti-floridani Ophcf2|01465 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2713
Ophiocordyceps kimflemingae Ophio5|3839
Ophiocordyceps subramaniannii Hirsu2|6156

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01465
MAPRTRTKSTKNSTATTGKAADAADAVDALTLSKFTLEASHGPAPKLFILPKLVTPEARIVLLPHPRHGRPARFI
VSPEAGFYEIKKVSAPTSSPRSWLIEHCAKASDEKDSKSGDAVVDYGAQVVADPELHMATAIDPLFFMIPALVDG
QPADESSARKRLLLSSDEYFDRLPDSSSHLTEILRWRDTRTLIERRMATVCDTVEAGDETMFRLNEEKLLKTMVD
KASKMGEGGLPPSMEDKFVKRALEAPVLLSNTDAADCEIPNNEASDVVANAAEVPPDVVRLQRLRTAFNFICSSY
LPPPLAEKLQRQLKNSTCTDFSALEDYLAKLARLRAEAAELSSLANVPQKRSSEDEVADAQAEKKRKLEEDKQRK
ASETRGVRELKKVNTSGMKKLSHFFKKT*
Coding >Ophcf2|01465
ATGGCCCCAAGGACCCGGACGAAATCGACGAAAAATAGCACCGCGACGACAGGGAAAGCAGCCGATGCCGCCGAC
GCTGTAGACGCCCTCACGCTCTCCAAGTTCACACTCGAAGCCAGTCACGGGCCTGCGCCGAAGCTGTTCATCCTC
CCAAAGCTCGTCACTCCCGAGGCCCGTATTGTCCTCCTGCCTCATCCCAGACACGGCCGACCAGCCCGCTTCATC
GTCTCTCCCGAGGCAGGCTTCTACGAAATCAAAAAGGTTTCCGCCCCGACATCGTCGCCCAGAAGTTGGCTCATC
GAGCATTGCGCCAAAGCGTCTGATGAGAAAGACTCCAAGTCTGGCGACGCAGTAGTAGATTATGGGGCGCAAGTC
GTCGCGGACCCGGAGCTACACATGGCGACGGCCATCGATCCGCTATTCTTCATGATACCGGCGCTGGTGGACGGG
CAGCCAGCCGACGAATCGTCTGCTAGGAAACGTCTATTACTGTCCAGCGACGAATATTTCGATAGACTACCGGAC
TCATCATCCCATCTCACCGAGATATTGCGATGGCGCGACACAAGGACATTGATCGAGAGACGAATGGCGACCGTT
TGCGATACCGTCGAGGCCGGCGATGAGACCATGTTTCGCCTAAACGAGGAAAAGCTTCTGAAGACGATGGTCGAT
AAGGCCAGCAAGATGGGCGAAGGAGGCCTGCCGCCCAGCATGGAGGACAAGTTCGTGAAAAGAGCGCTCGAGGCC
CCCGTTCTCCTGTCCAACACCGATGCCGCCGACTGCGAAATTCCAAATAACGAAGCCAGCGATGTCGTCGCCAAC
GCCGCAGAAGTGCCACCGGACGTTGTACGTCTCCAGCGACTGCGGACAGCGTTCAACTTCATCTGCTCCAGTTAC
CTGCCGCCACCTCTCGCGGAGAAGCTCCAGCGGCAGCTCAAGAATTCGACATGCACAGACTTCTCCGCTCTGGAA
GACTACCTTGCCAAGCTGGCTCGGCTGCGGGCAGAGGCGGCGGAATTGAGCTCCTTGGCCAACGTGCCCCAAAAG
CGTTCGAGTGAGGATGAAGTCGCAGACGCCCAAGCCGAGAAGAAGAGGAAGCTGGAGGAGGATAAGCAGCGAAAG
GCGAGCGAGACTCGAGGCGTGAGGGAACTCAAAAAAGTCAACACCAGTGGGATGAAGAAGTTGAGCCACTTTTTC
AAAAAGACGTGA
Transcript >Ophcf2|01465
ATGGCCCCAAGGACCCGGACGAAATCGACGAAAAATAGCACCGCGACGACAGGGAAAGCAGCCGATGCCGCCGAC
GCTGTAGACGCCCTCACGCTCTCCAAGTTCACACTCGAAGCCAGTCACGGGCCTGCGCCGAAGCTGTTCATCCTC
CCAAAGCTCGTCACTCCCGAGGCCCGTATTGTCCTCCTGCCTCATCCCAGACACGGCCGACCAGCCCGCTTCATC
GTCTCTCCCGAGGCAGGCTTCTACGAAATCAAAAAGGTTTCCGCCCCGACATCGTCGCCCAGAAGTTGGCTCATC
GAGCATTGCGCCAAAGCGTCTGATGAGAAAGACTCCAAGTCTGGCGACGCAGTAGTAGATTATGGGGCGCAAGTC
GTCGCGGACCCGGAGCTACACATGGCGACGGCCATCGATCCGCTATTCTTCATGATACCGGCGCTGGTGGACGGG
CAGCCAGCCGACGAATCGTCTGCTAGGAAACGTCTATTACTGTCCAGCGACGAATATTTCGATAGACTACCGGAC
TCATCATCCCATCTCACCGAGATATTGCGATGGCGCGACACAAGGACATTGATCGAGAGACGAATGGCGACCGTT
TGCGATACCGTCGAGGCCGGCGATGAGACCATGTTTCGCCTAAACGAGGAAAAGCTTCTGAAGACGATGGTCGAT
AAGGCCAGCAAGATGGGCGAAGGAGGCCTGCCGCCCAGCATGGAGGACAAGTTCGTGAAAAGAGCGCTCGAGGCC
CCCGTTCTCCTGTCCAACACCGATGCCGCCGACTGCGAAATTCCAAATAACGAAGCCAGCGATGTCGTCGCCAAC
GCCGCAGAAGTGCCACCGGACGTTGTACGTCTCCAGCGACTGCGGACAGCGTTCAACTTCATCTGCTCCAGTTAC
CTGCCGCCACCTCTCGCGGAGAAGCTCCAGCGGCAGCTCAAGAATTCGACATGCACAGACTTCTCCGCTCTGGAA
GACTACCTTGCCAAGCTGGCTCGGCTGCGGGCAGAGGCGGCGGAATTGAGCTCCTTGGCCAACGTGCCCCAAAAG
CGTTCGAGTGAGGATGAAGTCGCAGACGCCCAAGCCGAGAAGAAGAGGAAGCTGGAGGAGGATAAGCAGCGAAAG
GCGAGCGAGACTCGAGGCGTGAGGGAACTCAAAAAAGTCAACACCAGTGGGATGAAGAAGTTGAGCCACTTTTTC
AAAAAGACGTGA
Gene >Ophcf2|01465
ATGGCCCCAAGGACCCGGACGAAATCGACGAAAAATAGCACCGCGACGACAGGGAAAGCAGCCGATGCCGCCGAC
GCTGTAGACGCCCTCACGCTCTCCAAGTTCACACTCGAAGCCAGTCACGGGCCTGCGCCGAAGCTGTTCATCCTC
CCAAAGCTCGTCACTCCCGAGGCCCGTATTGTCCTCCTGCCTCATCCCAGACACGGCCGACCAGCCCGCTTCATC
GTCTCTCCCGAGGCAGGCTTCTACGAAATCAAAAAGGTTTCCGCCCCGACATCGTCGCCCAGAAGTTGGCTCATC
GAGCATTGCGCCAAAGCGTCTGATGAGAAAGACTCCAAGTCTGGCGACGCAGTAGTAGATTATGGGGCGCAAGTC
GTCGCGGACCCGGAGCTACACATGGCGACGGCCATCGATCCGCTATTCTTCATGATACCGGCGCTGGTGGACGGG
CAGCCAGCCGACGAATCGTCTGCTAGGAAACGTCTATTACTGTCCAGCGACGAATATTTCGATAGACTACCGGAC
TCATCATCCCATCTCACCGAGATATTGCGATGGCGCGACACAAGGACATTGATCGAGAGACGAATGGCGACCGTT
TGCGATACCGTCGAGGCCGGCGATGAGACCATGTTTCGCCTAAACGAGGAAAAGCTTCTGAAGACGATGGTCGAT
AAGGCCAGCAAGATGGGCGAAGGAGGCCTGCCGCCCAGCATGGAGGACAAGTTCGTGAAAAGAGCGCTCGAGGCC
CCCGTTCTCCTGTCCAACACCGATGCCGCCGACTGCGAAATTCCAAATAACGAAGCCAGCGATGTCGTCGCCAAC
GCCGCAGAAGTGCCACCGGACGTTGTACGTCTCCAGCGACTGCGGACAGCGTTCAACTTCATCTGCTCCAGTTAC
CTGCCGCCACCTCTCGCGGAGAAGCTCCAGCGGCAGCTCAAGAATTCGACATGCACAGACTTCTCCGCTCTGGAA
GACTACCTTGCCAAGCTGGCTCGGCTGCGGGCAGAGGCGGCGGAATTGAGCTCCTTGGCCAACGTGCCCCAAAAG
CGTTCGAGTGAGGATGAAGTCGCAGACGCCCAAGCCGAGAAGAAGAGGAAGCTGGAGGAGGATAAGCAGCGAAAG
GCGAGCGAGACTCGAGGCGTGAGGGAACTCAAAAAAGTCAACACCAGTGGGATGAAGAAGTTGAGCCACTTTTTC
AAAAAGACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail