Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01459
Gene name
Locationscaffold_01:5058170..5062416
Strand-
Gene length (bp)4246
Transcript length (bp)4128
Coding sequence length (bp)4128
Protein length (aa) 1376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 4.6E-40 1034 1214
PF00122 E1-E2_ATPase E1-E2 ATPase 5.5E-34 380 591
PF13246 Cation_ATPase Cation transport ATPase (P-type) 2.1E-22 680 770
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 6.5E-20 608 960
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.7E-04 280 322
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 5.1E-05 932 993

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 312 331 19
2 344 366 22
3 515 537 22
4 558 580 22
5 1006 1028 22
6 1035 1057 22
7 1084 1103 19
8 1160 1182 22
9 1192 1214 22
10 1332 1354 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01459
MPGPSDPETPQGSHPLGRRRAPTITIDTTAVNTHHDAEISPDPRPHPNSSLSPQEDITTPSTIVDPPAGLSPGAL
YPDISLDNRDGSRPTSPHNISNPLLPRASDSGAAYLSVPSNHSRPRQNSTDSQEVSALSISSQGETTMVASSHTQ
ANKFKVSGNDKIMKDQNALAPDAGTEADFDFPDNPFAFSPGQLNKMFNPKSLAAFYKLGGLSGLEKGLRTDRKAG
LSPDEAQLSGHVTFEEATTKGHDDFMMQSKKGIKVETIAHAATTRSRPSDQKPFSDRHRVFKDNNIPPRKGKTFL
QLVVATYNDKMLILLSIAAVISLAIGLYQTFDTQHKDGEPKIDWVEGVAIVAAIAIVVAVASLTDWSRERRFSKL
NKKKQDRDVRVVRCGKTTEIFVGDIMVGDVVHLEPGDVVPADGVLIAGFNLKCDESQTTGESDIIRKRPSDEVYA
AIGDHESLKKMDPFIQSGARIMEGVGTYLVTSTGTYSTHGRTLMALNEDPEVTPLQVKLNLVATWIAKMGCAVGL
LLFIVLFIQFLVRLPRLTDSTPAEKGRMFLDIFIMVVTIIVVAVPEGLPLAVTLALSFATSRMLKNGNLVRYLKA
CEVMGNATTICSDKTGTLTQNKMQIVAATVGTSLRFGGTRPESRDDEDATTPIDTGADITAVDFASMLSASVKEL
LVKSIALNSTAFEGEVEGEKTFIGSKTETALLLFAREYLGMGSVSEERDGATTLQMVPFDSSRKCMGIVVGLPEG
RARLYVKGASEIVLGRCTQILRDAAVNDSVAALSPSNSETVTHMIESYAMRSLRTIGICYRDFDAWPPKEARTGD
GGKEDIEFGDMFRNMCFIGMVGIQDPLREGVYESVKVCQQAGVVVRMVTGDNKLTAQAIAKECGILQPNSIVMEG
PDFRNLSKLQQEEIIPRLHVLARSSPEDKRILVKRLKDKNETVAVTGDGTNDAPALKMADVGFSMGIAGTEVAKE
ASDIILMDDNFSSIVRALKWGRAVNDGVKRFLQFQLTVNITAVVLTFVTAVSSQQEKAVLTAVQLLWVNLIMDTL
AALALATDPPQDSVVKRLPEPKGAPLVSITMWKMILGQTAYQLVITFILYYGIPQHWFDPFTIRDELLPEEVNTM
VFNTFVWMQIFNQWNNRRLDNRFNIFEGLSKNWIFVVISILMCGGQVLIIFIGGAAFQIAKQGQDGSQWLMAVVL
GLLSIPMGVVLRLIPDEAIAALIPGFLKNRARRVPGLTVSDEEMGQYPEPLAELRDQLKFMRRMKGGRLNNLKFK
IQQRTETVLRQRSRSPSHSRSDSTKAPRTPTREDSTGEVRASTPESRHRARSTRSRSNSALGAPTVMAGIVAAGV
AAGWSPTGRVNAEENSTDEKGSGSR*
Coding >Ophcf2|01459
ATGCCGGGCCCCAGTGATCCGGAGACGCCTCAAGGCTCTCATCCGCTGGGTAGGAGACGGGCCCCAACCATCACT
ATCGATACAACGGCCGTCAACACCCATCATGACGCCGAAATTTCACCCGACCCTCGACCGCACCCGAACTCGTCT
CTGTCGCCGCAAGAAGACATCACCACTCCCTCGACGATAGTCGATCCTCCCGCCGGCTTGAGCCCTGGCGCCCTC
TATCCCGACATCTCTCTCGACAACAGAGATGGTAGCCGGCCCACGAGTCCGCACAACATCTCCAACCCGCTGCTA
CCGCGCGCCAGTGACAGCGGAGCTGCCTATCTCTCCGTCCCATCCAATCACTCGCGCCCGCGGCAGAACTCGACC
GACTCCCAGGAGGTGTCGGCCCTCTCCATCAGCTCCCAGGGCGAGACCACCATGGTCGCATCCAGCCACACCCAG
GCCAATAAGTTCAAGGTCTCCGGCAACGATAAGATCATGAAGGATCAGAATGCCTTGGCTCCCGATGCCGGCACC
GAGGCCGATTTTGACTTCCCCGACAACCCATTTGCTTTTTCTCCCGGCCAGCTCAACAAGATGTTCAATCCCAAG
AGCCTGGCTGCTTTCTATAAGCTCGGCGGCTTGAGCGGCCTCGAGAAGGGTCTAAGGACAGACCGCAAGGCTGGC
CTGAGTCCTGACGAGGCTCAACTGAGTGGACACGTAACCTTTGAAGAAGCCACGACAAAGGGTCACGATGATTTC
ATGATGCAATCCAAAAAGGGAATTAAAGTAGAAACGATCGCTCACGCGGCGACTACGAGATCGAGGCCCTCGGAT
CAGAAACCCTTTTCTGATAGGCATCGTGTCTTCAAGGACAACAACATACCGCCGAGAAAGGGCAAGACGTTTCTT
CAGCTCGTCGTGGCCACATACAACGACAAAATGCTCATTCTGCTATCGATCGCGGCCGTTATCAGCCTGGCCATC
GGTTTATACCAGACCTTTGACACCCAGCACAAGGACGGCGAGCCCAAGATCGACTGGGTCGAAGGAGTCGCCATT
GTCGCTGCCATAGCCATCGTGGTCGCGGTCGCGTCACTCACAGACTGGTCCAGGGAGCGCCGGTTTTCCAAACTC
AACAAGAAGAAGCAGGACCGCGATGTCCGCGTCGTACGCTGCGGGAAGACGACGGAGATTTTCGTTGGCGACATA
ATGGTCGGCGACGTCGTTCACCTGGAGCCTGGTGACGTTGTGCCTGCCGACGGCGTGCTGATCGCCGGCTTCAAC
CTCAAATGCGACGAATCCCAGACGACGGGCGAGTCGGATATCATCCGCAAACGGCCTTCTGACGAAGTCTACGCC
GCCATTGGGGATCACGAGAGTCTCAAGAAGATGGACCCCTTTATTCAGTCTGGCGCCCGCATCATGGAGGGAGTC
GGCACCTACTTGGTCACCTCCACGGGCACCTATTCGACCCATGGCAGGACGCTCATGGCCCTCAACGAGGACCCA
GAGGTGACGCCCCTCCAAGTCAAGCTCAACCTCGTGGCCACCTGGATCGCCAAGATGGGCTGCGCTGTTGGCTTG
CTCCTGTTCATCGTCCTCTTCATTCAGTTCCTGGTCCGGCTTCCACGGCTCACCGACAGTACCCCGGCAGAAAAG
GGTCGGATGTTCCTCGACATCTTCATCATGGTCGTCACCATCATCGTCGTTGCTGTCCCGGAAGGCCTCCCGCTT
GCCGTGACGCTGGCCTTGTCCTTTGCCACGTCACGCATGCTCAAGAACGGCAACCTGGTCCGCTATCTCAAGGCG
TGCGAGGTCATGGGCAACGCCACAACTATCTGCTCGGATAAGACGGGAACCCTCACCCAGAACAAGATGCAGATC
GTCGCGGCCACGGTCGGGACCAGCCTTAGGTTCGGCGGCACTCGACCGGAGTCACGGGATGATGAAGACGCGACG
ACGCCCATCGACACGGGGGCCGACATCACGGCGGTCGACTTCGCGTCCATGCTCAGTGCTTCGGTCAAGGAGCTA
CTGGTCAAGTCCATCGCTCTCAACTCGACGGCCTTTGAGGGCGAAGTGGAGGGAGAGAAGACGTTTATCGGTTCC
AAGACGGAGACGGCGCTGCTGCTCTTCGCCAGAGAGTACCTGGGCATGGGATCCGTCAGCGAAGAGCGGGATGGC
GCCACGACGCTTCAGATGGTGCCTTTTGACTCGAGCAGAAAATGCATGGGCATCGTCGTCGGACTCCCCGAGGGT
CGGGCTCGGCTATACGTCAAGGGTGCGTCGGAGATTGTGCTCGGGCGGTGCACGCAGATACTGCGAGACGCGGCC
GTCAACGACTCGGTGGCTGCGCTCTCGCCGAGCAACAGCGAGACGGTGACGCACATGATTGAGAGCTACGCGATG
CGCTCCCTCCGGACTATCGGCATCTGCTACCGAGACTTTGACGCCTGGCCGCCCAAGGAAGCCCGCACTGGAGAC
GGGGGCAAGGAGGACATCGAGTTTGGCGACATGTTCCGCAACATGTGCTTCATCGGCATGGTCGGCATCCAGGAT
CCCTTGCGCGAGGGCGTGTACGAGTCGGTCAAAGTCTGCCAGCAGGCGGGCGTGGTCGTGCGCATGGTGACGGGA
GACAACAAGTTGACGGCACAGGCCATCGCTAAGGAGTGCGGCATCCTGCAGCCCAACAGCATCGTCATGGAGGGC
CCCGACTTCCGTAACCTCAGCAAGCTGCAGCAGGAGGAGATTATTCCGAGGCTGCACGTGCTGGCGAGGTCCAGC
CCCGAGGACAAGCGAATTCTGGTCAAGCGGCTCAAGGACAAGAACGAGACGGTGGCGGTGACGGGCGACGGCACC
AACGACGCGCCGGCGCTCAAGATGGCTGATGTCGGCTTCTCGATGGGCATCGCCGGCACAGAGGTTGCCAAGGAG
GCCTCCGACATCATCCTCATGGACGACAACTTTTCGAGCATCGTCAGGGCGCTCAAATGGGGGCGAGCGGTCAAC
GACGGAGTCAAGCGGTTCTTGCAGTTTCAGCTGACGGTCAACATTACCGCCGTCGTCCTCACCTTTGTGACTGCA
GTATCGAGCCAGCAGGAGAAGGCGGTGCTGACGGCGGTGCAACTGCTATGGGTCAACCTCATCATGGACACGCTG
GCGGCGCTGGCGCTGGCGACGGACCCGCCGCAGGACAGCGTGGTTAAGAGGCTGCCAGAGCCCAAGGGCGCGCCG
CTGGTGTCGATTACGATGTGGAAGATGATTCTGGGCCAGACGGCCTACCAGCTCGTCATCACGTTTATACTCTAC
TATGGAATACCCCAGCACTGGTTCGATCCTTTTACGATAAGGGACGAGCTGCTTCCGGAAGAGGTCAACACGATG
GTGTTTAACACGTTTGTGTGGATGCAGATTTTCAACCAGTGGAACAATCGACGACTGGACAACCGGTTCAACATT
TTTGAGGGCCTCAGCAAGAATTGGATCTTCGTCGTCATCAGCATTCTCATGTGCGGCGGGCAGGTCCTCATCATC
TTCATTGGGGGAGCGGCGTTCCAGATCGCCAAGCAGGGACAGGACGGTTCGCAGTGGTTGATGGCGGTGGTCCTG
GGGCTGCTATCGATACCGATGGGCGTTGTGTTGCGTCTGATTCCGGACGAGGCCATTGCGGCGCTGATACCGGGC
TTCCTGAAGAACAGAGCGCGGCGGGTGCCGGGGCTGACGGTGTCTGACGAGGAGATGGGCCAGTACCCGGAGCCG
CTGGCGGAACTTCGAGACCAGCTCAAGTTTATGCGACGGATGAAGGGCGGGCGGCTGAACAACCTCAAGTTCAAG
ATTCAGCAGCGGACGGAGACTGTGCTGAGACAGCGGTCACGGAGCCCGTCGCACTCGCGGTCGGACTCGACCAAG
GCGCCTCGGACGCCGACGCGGGAGGACAGCACGGGCGAAGTGAGGGCGTCGACGCCGGAGTCGAGGCATCGGGCG
CGGTCTACGCGGTCACGGTCCAACTCGGCGCTGGGGGCACCGACGGTCATGGCGGGCATCGTGGCGGCGGGCGTG
GCGGCCGGATGGTCGCCGACGGGACGGGTCAACGCGGAGGAGAATAGCACGGATGAAAAGGGGAGCGGGAGCCGG
TAG
Transcript >Ophcf2|01459
ATGCCGGGCCCCAGTGATCCGGAGACGCCTCAAGGCTCTCATCCGCTGGGTAGGAGACGGGCCCCAACCATCACT
ATCGATACAACGGCCGTCAACACCCATCATGACGCCGAAATTTCACCCGACCCTCGACCGCACCCGAACTCGTCT
CTGTCGCCGCAAGAAGACATCACCACTCCCTCGACGATAGTCGATCCTCCCGCCGGCTTGAGCCCTGGCGCCCTC
TATCCCGACATCTCTCTCGACAACAGAGATGGTAGCCGGCCCACGAGTCCGCACAACATCTCCAACCCGCTGCTA
CCGCGCGCCAGTGACAGCGGAGCTGCCTATCTCTCCGTCCCATCCAATCACTCGCGCCCGCGGCAGAACTCGACC
GACTCCCAGGAGGTGTCGGCCCTCTCCATCAGCTCCCAGGGCGAGACCACCATGGTCGCATCCAGCCACACCCAG
GCCAATAAGTTCAAGGTCTCCGGCAACGATAAGATCATGAAGGATCAGAATGCCTTGGCTCCCGATGCCGGCACC
GAGGCCGATTTTGACTTCCCCGACAACCCATTTGCTTTTTCTCCCGGCCAGCTCAACAAGATGTTCAATCCCAAG
AGCCTGGCTGCTTTCTATAAGCTCGGCGGCTTGAGCGGCCTCGAGAAGGGTCTAAGGACAGACCGCAAGGCTGGC
CTGAGTCCTGACGAGGCTCAACTGAGTGGACACGTAACCTTTGAAGAAGCCACGACAAAGGGTCACGATGATTTC
ATGATGCAATCCAAAAAGGGAATTAAAGTAGAAACGATCGCTCACGCGGCGACTACGAGATCGAGGCCCTCGGAT
CAGAAACCCTTTTCTGATAGGCATCGTGTCTTCAAGGACAACAACATACCGCCGAGAAAGGGCAAGACGTTTCTT
CAGCTCGTCGTGGCCACATACAACGACAAAATGCTCATTCTGCTATCGATCGCGGCCGTTATCAGCCTGGCCATC
GGTTTATACCAGACCTTTGACACCCAGCACAAGGACGGCGAGCCCAAGATCGACTGGGTCGAAGGAGTCGCCATT
GTCGCTGCCATAGCCATCGTGGTCGCGGTCGCGTCACTCACAGACTGGTCCAGGGAGCGCCGGTTTTCCAAACTC
AACAAGAAGAAGCAGGACCGCGATGTCCGCGTCGTACGCTGCGGGAAGACGACGGAGATTTTCGTTGGCGACATA
ATGGTCGGCGACGTCGTTCACCTGGAGCCTGGTGACGTTGTGCCTGCCGACGGCGTGCTGATCGCCGGCTTCAAC
CTCAAATGCGACGAATCCCAGACGACGGGCGAGTCGGATATCATCCGCAAACGGCCTTCTGACGAAGTCTACGCC
GCCATTGGGGATCACGAGAGTCTCAAGAAGATGGACCCCTTTATTCAGTCTGGCGCCCGCATCATGGAGGGAGTC
GGCACCTACTTGGTCACCTCCACGGGCACCTATTCGACCCATGGCAGGACGCTCATGGCCCTCAACGAGGACCCA
GAGGTGACGCCCCTCCAAGTCAAGCTCAACCTCGTGGCCACCTGGATCGCCAAGATGGGCTGCGCTGTTGGCTTG
CTCCTGTTCATCGTCCTCTTCATTCAGTTCCTGGTCCGGCTTCCACGGCTCACCGACAGTACCCCGGCAGAAAAG
GGTCGGATGTTCCTCGACATCTTCATCATGGTCGTCACCATCATCGTCGTTGCTGTCCCGGAAGGCCTCCCGCTT
GCCGTGACGCTGGCCTTGTCCTTTGCCACGTCACGCATGCTCAAGAACGGCAACCTGGTCCGCTATCTCAAGGCG
TGCGAGGTCATGGGCAACGCCACAACTATCTGCTCGGATAAGACGGGAACCCTCACCCAGAACAAGATGCAGATC
GTCGCGGCCACGGTCGGGACCAGCCTTAGGTTCGGCGGCACTCGACCGGAGTCACGGGATGATGAAGACGCGACG
ACGCCCATCGACACGGGGGCCGACATCACGGCGGTCGACTTCGCGTCCATGCTCAGTGCTTCGGTCAAGGAGCTA
CTGGTCAAGTCCATCGCTCTCAACTCGACGGCCTTTGAGGGCGAAGTGGAGGGAGAGAAGACGTTTATCGGTTCC
AAGACGGAGACGGCGCTGCTGCTCTTCGCCAGAGAGTACCTGGGCATGGGATCCGTCAGCGAAGAGCGGGATGGC
GCCACGACGCTTCAGATGGTGCCTTTTGACTCGAGCAGAAAATGCATGGGCATCGTCGTCGGACTCCCCGAGGGT
CGGGCTCGGCTATACGTCAAGGGTGCGTCGGAGATTGTGCTCGGGCGGTGCACGCAGATACTGCGAGACGCGGCC
GTCAACGACTCGGTGGCTGCGCTCTCGCCGAGCAACAGCGAGACGGTGACGCACATGATTGAGAGCTACGCGATG
CGCTCCCTCCGGACTATCGGCATCTGCTACCGAGACTTTGACGCCTGGCCGCCCAAGGAAGCCCGCACTGGAGAC
GGGGGCAAGGAGGACATCGAGTTTGGCGACATGTTCCGCAACATGTGCTTCATCGGCATGGTCGGCATCCAGGAT
CCCTTGCGCGAGGGCGTGTACGAGTCGGTCAAAGTCTGCCAGCAGGCGGGCGTGGTCGTGCGCATGGTGACGGGA
GACAACAAGTTGACGGCACAGGCCATCGCTAAGGAGTGCGGCATCCTGCAGCCCAACAGCATCGTCATGGAGGGC
CCCGACTTCCGTAACCTCAGCAAGCTGCAGCAGGAGGAGATTATTCCGAGGCTGCACGTGCTGGCGAGGTCCAGC
CCCGAGGACAAGCGAATTCTGGTCAAGCGGCTCAAGGACAAGAACGAGACGGTGGCGGTGACGGGCGACGGCACC
AACGACGCGCCGGCGCTCAAGATGGCTGATGTCGGCTTCTCGATGGGCATCGCCGGCACAGAGGTTGCCAAGGAG
GCCTCCGACATCATCCTCATGGACGACAACTTTTCGAGCATCGTCAGGGCGCTCAAATGGGGGCGAGCGGTCAAC
GACGGAGTCAAGCGGTTCTTGCAGTTTCAGCTGACGGTCAACATTACCGCCGTCGTCCTCACCTTTGTGACTGCA
GTATCGAGCCAGCAGGAGAAGGCGGTGCTGACGGCGGTGCAACTGCTATGGGTCAACCTCATCATGGACACGCTG
GCGGCGCTGGCGCTGGCGACGGACCCGCCGCAGGACAGCGTGGTTAAGAGGCTGCCAGAGCCCAAGGGCGCGCCG
CTGGTGTCGATTACGATGTGGAAGATGATTCTGGGCCAGACGGCCTACCAGCTCGTCATCACGTTTATACTCTAC
TATGGAATACCCCAGCACTGGTTCGATCCTTTTACGATAAGGGACGAGCTGCTTCCGGAAGAGGTCAACACGATG
GTGTTTAACACGTTTGTGTGGATGCAGATTTTCAACCAGTGGAACAATCGACGACTGGACAACCGGTTCAACATT
TTTGAGGGCCTCAGCAAGAATTGGATCTTCGTCGTCATCAGCATTCTCATGTGCGGCGGGCAGGTCCTCATCATC
TTCATTGGGGGAGCGGCGTTCCAGATCGCCAAGCAGGGACAGGACGGTTCGCAGTGGTTGATGGCGGTGGTCCTG
GGGCTGCTATCGATACCGATGGGCGTTGTGTTGCGTCTGATTCCGGACGAGGCCATTGCGGCGCTGATACCGGGC
TTCCTGAAGAACAGAGCGCGGCGGGTGCCGGGGCTGACGGTGTCTGACGAGGAGATGGGCCAGTACCCGGAGCCG
CTGGCGGAACTTCGAGACCAGCTCAAGTTTATGCGACGGATGAAGGGCGGGCGGCTGAACAACCTCAAGTTCAAG
ATTCAGCAGCGGACGGAGACTGTGCTGAGACAGCGGTCACGGAGCCCGTCGCACTCGCGGTCGGACTCGACCAAG
GCGCCTCGGACGCCGACGCGGGAGGACAGCACGGGCGAAGTGAGGGCGTCGACGCCGGAGTCGAGGCATCGGGCG
CGGTCTACGCGGTCACGGTCCAACTCGGCGCTGGGGGCACCGACGGTCATGGCGGGCATCGTGGCGGCGGGCGTG
GCGGCCGGATGGTCGCCGACGGGACGGGTCAACGCGGAGGAGAATAGCACGGATGAAAAGGGGAGCGGGAGCCGG
TAG
Gene >Ophcf2|01459
ATGCCGGGCCCCAGTGATCCGGAGACGCCTCAAGGCTCTCATCCGCTGGGTAGGAGACGGGCGTGAGTTTCGACC
TTTTCTTTGGCCCTCCTCTCGTCTAGGTCCTAACAGCCCGATTTAGCCCAACCATCACTATCGATACAACGGCCG
TCAACACCCATCATGACGCCGAAATTTCACCCGACCCTCGACCGCACCCGAACTCGTCTCTGTCGCCGCAAGAAG
ACATCACCACTCCCTCGACGATAGTCGATCCTCCCGCCGGCTTGAGCCCTGGCGCCCTCTATCCCGACATCTCTC
TCGACAACAGAGATGGTAGCCGGCCCACGAGTCCGCACAACATCTCCAACCCGCTGCTACCGCGCGCCAGTGACA
GCGGAGCTGCCTATCTCTCCGTCCCATCCAATCACTCGCGCCCGCGGCAGAACTCGACCGACTCCCAGGAGGTGT
CGGCCCTCTCCATCAGCTCCCAGGGCGAGACCACCATGGTCGCATCCAGCCACACCCAGGCCAATAAGTTCAAGG
TCTCCGGCAACGATAAGATCATGAAGGATCAGAATGCCTTGGCTCCCGATGCCGGCACCGAGGCCGATTTTGACT
TCCCCGACAACCCATTTGCTTTTTCTCCCGGCCAGCTCAACAAGATGTTCAATCCCAAGAGCCTGGCTGCTTTCT
ATAAGCTCGGCGGCTTGAGCGGCCTCGAGAAGGGTCTAAGGACAGACCGCAAGGCTGGCCTGAGTCCTGACGAGG
CTCAACTGAGTGGACACGTAACCTTTGAAGAAGCCACGACAAAGGGTCACGATGATTTCATGATGCAATCCAAAA
AGGGAATTAAAGTAGAAACGATCGCTCACGCGGCGACTACGAGATCGAGGCCCTCGGATCAGAAACCCTTTTCTG
ATAGGCATCGTGTCTTCAAGGACAACAACATACCGCCGAGAAAGGGCAAGACGTTTCTTCAGCTCGTCGTGGCCA
CATACAACGACAAAATGCTCATTCTGCTATCGATCGCGGCCGTTATCAGCCTGGCCATCGGTTTATACCAGACCT
TTGACACCCAGCACAAGGACGGCGAGCCCAAGATCGACTGGGTCGAAGGAGTCGCCATTGTCGCTGCCATAGCCA
TCGTGGTCGCGGTCGCGTCACTCACAGACTGGTCCAGGGAGCGCCGGTTTTCCAAACTCAACAAGAAGAAGCAGG
ACCGCGATGTCCGCGTCGTACGCTGCGGGAAGACGACGGAGATTTTCGTTGGCGACATAATGGTCGGCGACGTCG
TTCACCTGGAGCCTGGTGACGTTGTGCCTGCCGACGGCGTGCTGATCGCCGGCTTCAACCTCAAATGCGACGAAT
CCCAGACGACGGGCGAGTCGGATATCATCCGCAAACGGCCTTCTGACGAAGTCTACGCCGCCATTGGGGATCACG
AGAGTCTCAAGAAGATGGACCCCTTTATTCAGTCTGGCGCCCGCATCATGGAGGGAGTCGGCACCTACTTGGTCA
CCTCCACGGGCACCTATTCGACCCATGGCAGGACGCTCATGGCCCTCAACGAGGACCCAGAGGTGACGCCCCTCC
AAGTCAAGCTCAACCTCGTGGCCACCTGGATCGCCAAGATGGGCTGCGCTGTTGGCTTGCTCCTGTTCATCGTCC
TCTTCATTCAGTTCCTGGTCCGGCTTCCACGGCTCACCGACAGTACCCCGGCAGAAAAGGGTCGGATGTTCCTCG
ACATCTTCATCATGGTCGTCACCATCATCGTCGTTGCTGTCCCGGAAGGCCTCCCGCTTGCCGTGACGCTGGCCT
TGTCCTTTGCCACGTCACGCATGCTCAAGAACGGCAACCTGGTCCGCTATCTCAAGGCGTGCGAGGTCATGGGCA
ACGCCACAACTATCTGCTCGGATAAGACGGGAACCCTCACCCAGAACAAGATGCAGATCGTCGCGGCCACGGTCG
GGACCAGCCTTAGGTTCGGCGGCACTCGACCGGAGTCACGGGATGATGAAGACGCGACGACGCCCATCGACACGG
GGGCCGACATCACGGCGGTCGACTTCGCGTCCATGCTCAGTGCTTCGGTCAAGGAGCTACTGGTCAAGTCCATCG
CTCTCAACTCGACGGCCTTTGAGGGCGAAGTGGAGGGAGAGAAGACGTTTATCGGTTCCAAGACGGAGACGGCGC
TGCTGCTCTTCGCCAGAGAGTACCTGGGCATGGGATCCGTCAGCGAAGAGCGGGATGGCGCCACGACGCTTCAGA
TGGTGCCTTTTGACTCGAGCAGAAAATGCATGGGCATCGTCGTCGGACTCCCCGAGGGTCGGGCTCGGCTATACG
TCAAGGGTGCGTCGGAGATTGTGCTCGGGCGGTGCACGCAGATACTGCGAGACGCGGCCGTCAACGACTCGGTGG
CTGCGCTCTCGCCGAGCAACAGCGAGACGGTGACGCACATGATTGAGAGCTACGCGATGCGCTCCCTCCGGACTA
TCGGCATCTGCTACCGAGACTTTGACGCCTGGCCGCCCAAGGAAGCCCGCACTGGAGACGGGGGCAAGGAGGACA
TCGAGTTTGGCGACATGTTCCGCAACATGTGCTTCATCGGCATGGTCGGCATCCAGGATCCCTTGCGCGAGGGCG
TGTACGAGTCGGTCAAAGTCTGCCAGCAGGCGGGCGTGGTCGTGCGCATGGTGACGGGAGACAACAAGTTGACGG
CACAGGCCATCGCTAAGGAGTGCGGCATCCTGCAGCCCAACAGCATCGTCATGGAGGGCCCCGACTTCCGTAACC
TCAGCAAGCTGCAGCAGGAGGAGATTATTCCGAGGCTGCACGTGCTGGCGAGGTCCAGCCCCGAGGACAAGCGAA
TTCTGGTCAAGCGGCTCAAGGACAAGAACGAGACGGTGGCGGTGACGGGCGACGGCACCAACGACGCGCCGGCGC
TCAAGATGGCTGATGTCGGCTTCTCGATGGGCATCGCCGGCACAGAGGTTGCCAAGGAGGCCTCCGACATCATCC
TCATGGACGACAACTTTTCGAGCATCGTCAGGGCGCTCAAATGGGGGCGAGCGGTCAACGACGGAGTCAAGCGGT
TCTTGCAGTTTCAGCTGACGGTCAACATTACCGCCGTCGTCCTCACCTTTGTGACTGCAGTATCGAGCCAGCAGG
AGAAGGCGGTGCTGACGGCGGTGCAACTGCTATGGGTCAACCTCATCATGGACACGCTGGCGGCGCTGGCGCTGG
CGACGGACCCGCCGCAGGACAGCGTGGTTAAGAGGCTGCCAGAGCCCAAGGGCGCGCCGCTGGTGTCGATTACGA
TGTGGAAGATGATTCTGGGCCAGACGGCCTACCAGCTCGTCATCACGTTTATACTCTACTATGGAATACCCCAGC
ACTGGTTCGATCCTTTTACGATAAGGGACGAGCTGCTTCCGGAAGAGGTCAACACGATGGTGTTTAACACGTTTG
TGTGGATGCAGATTTTCAACCAGTGGAAGTGAGTCGAGCGTCGATGGAGGCAGAAATGGGTTGGGATCTTGCTGA
CTTTGTTGGTAGCAATCGACGACTGGACAACCGGTTCAACATTTTTGAGGGCCTCAGCAAGAATTGGATCTTCGT
CGTCATCAGCATTCTCATGTGCGGCGGGCAGGTCCTCATCATCTTCATTGGGGGAGCGGCGTTCCAGATCGCCAA
GCAGGGACAGGACGGTTCGCAGTGGTTGATGGCGGTGGTCCTGGGGCTGCTATCGATACCGATGGGCGTTGTGTT
GCGTCTGATTCCGGACGAGGCCATTGCGGCGCTGATACCGGGCTTCCTGAAGAACAGAGCGCGGCGGGTGCCGGG
GCTGACGGTGTCTGACGAGGAGATGGGCCAGTACCCGGAGCCGCTGGCGGAACTTCGAGACCAGCTCAAGTTTAT
GCGACGGATGAAGGGCGGGCGGCTGAACAACCTCAAGTTCAAGATTCAGCAGCGGACGGAGACTGTGCTGAGACA
GCGGTCACGGAGCCCGTCGCACTCGCGGTCGGACTCGACCAAGGCGCCTCGGACGCCGACGCGGGAGGACAGCAC
GGGCGAAGTGAGGGCGTCGACGCCGGAGTCGAGGCATCGGGCGCGGTCTACGCGGTCACGGTCCAACTCGGCGCT
GGGGGCACCGACGGTCATGGCGGGCATCGTGGCGGCGGGCGTGGCGGCCGGATGGTCGCCGACGGGACGGGTCAA
CGCGGAGGAGAATAGCACGGATGAAAAGGGGAGCGGGAGCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail