Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01455
Gene name
Locationscaffold_01:5049395..5049894
Strand+
Gene length (bp)499
Transcript length (bp)369
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10183 ESSS ESSS subunit of NADH:ubiquinone oxidoreductase (complex I) 1.8E-11 63 113

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0748 0.1202 0.0105 0.0816 0.9333 0.0159 0.0879 0.0438 0.0766 0.0073

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4880
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1943
Ophiocordyceps camponoti-floridani Ophcf2|01455 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1736
Ophiocordyceps kimflemingae Ophio5|5468
Ophiocordyceps subramaniannii Hirsu2|11175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01455
MALLIRRAHLPLRAVRCLRQPPASSRSFALSSRRLGGGHSNESQFDPPSGWLWGIKPGEKPEPEGWEWPFYLFAG
SLIATGVIWAYKPDTSVSTWALEEARRRLEAEGILPDPSPTQPQEKK*
Coding >Ophcf2|01455
ATGGCCCTCCTCATTCGGCGCGCCCATCTACCGCTGCGAGCTGTGCGATGCCTCCGCCAGCCCCCCGCCTCTTCG
CGCTCCTTCGCCCTATCCTCCCGACGACTGGGTGGCGGACACAGCAATGAGTCTCAGTTCGATCCTCCGTCGGGT
TGGCTTTGGGGCATCAAGCCCGGCGAGAAGCCCGAACCTGAGGGATGGGAGTGGCCATTCTACCTGTTCGCTGGG
AGCTTGATAGCCACCGGCGTTATCTGGGCTTACAAGCCTGACACGAGCGTCTCTACCTGGGCCCTCGAGGAAGCA
CGCCGAAGATTAGAAGCCGAGGGTATCCTCCCCGACCCGTCGCCGACGCAACCTCAAGAAAAGAAGTAG
Transcript >Ophcf2|01455
ATGGCCCTCCTCATTCGGCGCGCCCATCTACCGCTGCGAGCTGTGCGATGCCTCCGCCAGCCCCCCGCCTCTTCG
CGCTCCTTCGCCCTATCCTCCCGACGACTGGGTGGCGGACACAGCAATGAGTCTCAGTTCGATCCTCCGTCGGGT
TGGCTTTGGGGCATCAAGCCCGGCGAGAAGCCCGAACCTGAGGGATGGGAGTGGCCATTCTACCTGTTCGCTGGG
AGCTTGATAGCCACCGGCGTTATCTGGGCTTACAAGCCTGACACGAGCGTCTCTACCTGGGCCCTCGAGGAAGCA
CGCCGAAGATTAGAAGCCGAGGGTATCCTCCCCGACCCGTCGCCGACGCAACCTCAAGAAAAGAAGTAG
Gene >Ophcf2|01455
ATGGCCCTCCTCATTCGGCGCGCCCATCTACCGCTGCGAGCTGTGCGATGCCTCCGCCAGCCCCCCGCCTCTTCG
CGCTCCTTCGCCCTATCCTCCCGACGACTGGGTGGCGGACACAGCAATGAGTCTCAGTTCGATCCTCCGTCGGGT
TGGCTTTGGGGCATCAAGCCCGGCGAGAAGCCCGAACCTGAGGGATGGGAGTGGCCATTCTACCTGTTCGCTGGG
AGCTTGATAGCCACCGGCGTTATCTGGGCTTACAAGCCTGACACGAGGTCCGGTCTTCTCTTGTCGTCCCTTTGT
CCTTTGTTCTTGCCATACTTCTTTTCGCGTCTTTTCATAAAAACCATCCTGTCTTTTTCAAGTTCTCTGCTGATC
TTTGATCTCTCCTTTCCTCGCCTGCAGCGTCTCTACCTGGGCCCTCGAGGAAGCACGCCGAAGATTAGAAGCCGA
GGGTATCCTCCCCGACCCGTCGCCGACGCAACCTCAAGAAAAGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail