Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01454
Gene name
Locationscaffold_01:5045232..5048758
Strand-
Gene length (bp)3526
Transcript length (bp)3057
Coding sequence length (bp)3057
Protein length (aa) 1019

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 1.8E-07 661 779
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 3.6E-06 131 204

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 130 152 22
2 182 204 22
3 234 256 22
4 271 290 19
5 687 709 22
6 714 731 17
7 738 755 17
8 770 792 22
9 799 821 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 52.56 29.42 75.70
Alive In ants, during behavior modification 24.49 13.87 35.11
Dead In ants, recently dead 29.04 16.19 41.90

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.335547 no
Dead Fungus 0.000454 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01454
MSHQSSDVLRRRQQPLKLRPVPAPDAFLEPVSPPPISRPSSTHSLVQLDHMVSDKIDTETYGVSELRDGFFDAMF
LRPSHVFAADLLQDSADTLPAGFDKASPLALRRYFPRKRQALVSVVKRVTKTRDGIRLLKSFSAFFVAYVLCLLP
VIRNWLGRYHYIMAVSVIVNHPARSLGSQLDGAILTIVGAACGLAWGVLGLLLSESSVAARAGYAGVLAVWMALF
MTSISLTRAFFIRFYQAIHSAGLAVVFATLAETGSRQAEWTKLRDYGFAWLFGQAIALLINCVIFPDAGARDLAT
TFHAAFDVMLEALDASSRRDRRLRRRLSRAFVDLSQACRDMKIDITVTRVRPSDVGDLRNLMQAVIRALLTLKAD
TCLFKHSPSEHDVSITVDEPGLSILEAAVTAASSPDHSSRAIEELGDRTKNMLSCMSRCVRICDAILMDLSGHRR
GLGPAPDVPSDLQPAIRKLGQAKAAYDVVEASLIDSEERLPESSIQDGDVVQLFVFARHVREASSTIEHLVDKVQ
EVQQTSSGWPRPHLPSYPFWKALHRTNAQTRHDRGGVTAGSYHVTFEEIGRLLEKMKSNDHEPIRRTDSLCLDTV
ASRVSPDTTASPAKTSRARYKVWRVLKRLQGFESRYAFKVCLVTTLLAIPAYLVRDRGWWEDYECWWAVSISWLA
MHPRVGGNVQDLFIRGFMAILGAAWSAAAYVVGNGNPYVMAVFATVYMVPMLLRFTQSSHPRSGLIGCLSFTVIS
LRLMVESNDTSPTLLATYSGVAFLVGATVPVMVNWVLWPFVARHELRRALSSMMFFMSVIYRSVVARYVYFHEGK
EPTPEDVQRSEMLEGRLREGFVRIRQLLVLTQKEIRLRAPFDPLPYSALADSCERFFDYLVAVRQSALFYNPDYI
RDNPQAAEQLLSHRRDAVAAILGNLYILAGALRSKRKVPRYLPNAAAARRRLLMMNAQVDDETSRLSPSADAACH
KRWSDIYRYSYNESLVGCVAQLDELEKLTKLIVGEQRSGEFEV*
Coding >Ophcf2|01454
ATGTCCCATCAGTCTTCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAAGCTGCGGCCCGTGCCAGCTCCCGAT
GCCTTCCTCGAGCCCGTCTCCCCTCCGCCGATAAGCCGGCCGAGTTCTACTCATAGCCTTGTCCAGTTGGACCAC
ATGGTCTCGGACAAGATAGACACGGAGACGTACGGAGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTC
CTCAGACCGTCGCACGTGTTTGCCGCCGACCTGTTGCAAGATTCTGCCGATACGCTTCCCGCTGGTTTCGACAAG
GCATCGCCCCTGGCTTTGCGACGCTACTTTCCCCGGAAGCGTCAGGCCTTGGTGTCTGTCGTGAAGCGCGTAACG
AAGACCCGCGATGGAATCCGACTTCTCAAGTCTTTCTCGGCCTTCTTCGTCGCCTATGTCCTGTGCCTCTTGCCC
GTCATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCCAGATCA
TTGGGATCCCAGCTCGACGGTGCGATCCTCACCATTGTGGGTGCCGCCTGTGGACTGGCCTGGGGCGTGCTTGGC
TTGCTTCTGTCCGAGTCTTCGGTAGCTGCACGGGCTGGTTACGCGGGTGTCTTGGCTGTTTGGATGGCTCTGTTC
ATGACGTCCATCTCCCTCACTCGAGCCTTCTTCATACGATTCTATCAGGCTATACACTCGGCCGGTCTCGCCGTC
GTCTTTGCCACGCTGGCCGAGACGGGCAGCCGCCAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTGCCTGG
TTGTTCGGACAGGCCATTGCCTTGCTGATAAACTGCGTCATCTTCCCGGATGCCGGCGCGAGAGATCTGGCGACG
ACGTTTCACGCCGCTTTCGATGTGATGCTGGAGGCTCTCGATGCCTCGTCACGTCGAGACCGTCGACTCCGCCGG
CGTCTGTCGCGAGCGTTTGTTGACTTATCACAAGCATGTCGCGACATGAAGATCGATATCACCGTTACGCGCGTC
CGACCCAGTGACGTCGGGGACCTTCGCAACCTGATGCAGGCCGTTATCCGCGCTCTCCTCACTCTCAAGGCCGAC
ACTTGTCTGTTCAAGCACTCGCCCTCGGAACACGACGTCAGCATTACCGTCGACGAGCCTGGTCTGAGCATCCTG
GAAGCGGCCGTGACGGCGGCTTCGTCTCCGGACCACAGCAGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAG
AACATGCTCTCCTGCATGTCCCGATGCGTGCGAATCTGCGACGCTATCCTGATGGACCTGAGCGGACATCGTCGA
GGCTTAGGTCCCGCGCCGGACGTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCCGCC
TACGATGTCGTCGAGGCCAGTCTCATCGATTCGGAAGAGCGGCTACCGGAGTCTTCGATTCAGGATGGTGATGTC
GTCCAGCTCTTCGTCTTTGCTCGTCACGTCCGAGAGGCCTCGTCTACCATTGAGCATCTGGTAGACAAAGTCCAG
GAAGTGCAGCAGACGTCTTCCGGCTGGCCTCGTCCCCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATCGG
ACCAACGCCCAAACACGTCATGATCGTGGGGGGGTCACGGCCGGCTCATACCACGTCACTTTCGAGGAGATAGGT
CGCTTACTCGAGAAGATGAAGTCGAATGACCACGAGCCGATTCGACGAACAGACAGCCTCTGTCTGGATACCGTG
GCCTCACGCGTCTCGCCAGACACTACCGCCAGTCCAGCCAAGACGAGCCGCGCACGATACAAGGTCTGGCGCGTC
CTCAAACGTCTGCAGGGCTTCGAGAGCAGATACGCCTTCAAGGTCTGTCTCGTGACTACCCTGCTGGCCATCCCG
GCCTATCTGGTCCGGGACCGCGGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGGCTGGCC
ATGCACCCCCGAGTCGGAGGCAACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCCATCCTGGGCGCCGCCTGG
AGCGCGGCGGCGTATGTCGTCGGCAATGGCAACCCATACGTCATGGCAGTTTTTGCCACGGTCTACATGGTGCCC
ATGCTGCTTCGCTTCACGCAGAGTTCGCACCCGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTCATCTCG
CTTCGACTGATGGTGGAAAGCAACGACACGTCCCCTACTCTGCTGGCCACATACAGCGGCGTGGCATTCTTAGTT
GGCGCCACGGTTCCTGTCATGGTCAACTGGGTGTTGTGGCCGTTTGTCGCCAGACACGAGTTGAGGCGGGCTCTC
TCGTCCATGATGTTCTTTATGAGCGTCATCTACCGAAGCGTGGTGGCGAGATACGTCTACTTCCACGAGGGTAAA
GAACCAACACCAGAAGACGTACAGAGATCCGAAATGCTAGAAGGCCGCCTCAGAGAAGGCTTCGTCCGCATAAGA
CAACTCCTAGTCCTCACCCAGAAAGAAATCCGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCCCTCGCC
GACTCCTGCGAACGCTTCTTCGATTACCTCGTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGATTACATC
CGCGACAACCCACAAGCAGCAGAACAGCTCCTAAGCCACCGCCGCGACGCCGTAGCCGCCATCCTGGGAAACCTG
TACATCCTCGCCGGCGCCCTCCGTTCCAAGCGCAAAGTCCCCCGTTATCTACCCAACGCAGCCGCCGCTCGGAGA
AGGTTGCTCATGATGAACGCCCAAGTCGACGACGAAACGTCCCGTCTTTCCCCCTCCGCGGACGCAGCATGCCAC
AAACGCTGGAGCGACATCTACCGCTACTCGTATAACGAGAGTCTGGTGGGTTGCGTCGCGCAGCTGGATGAGCTG
GAGAAGCTCACCAAGCTCATCGTCGGCGAGCAGCGATCTGGCGAGTTCGAGGTTTAG
Transcript >Ophcf2|01454
ATGTCCCATCAGTCTTCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAAGCTGCGGCCCGTGCCAGCTCCCGAT
GCCTTCCTCGAGCCCGTCTCCCCTCCGCCGATAAGCCGGCCGAGTTCTACTCATAGCCTTGTCCAGTTGGACCAC
ATGGTCTCGGACAAGATAGACACGGAGACGTACGGAGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTC
CTCAGACCGTCGCACGTGTTTGCCGCCGACCTGTTGCAAGATTCTGCCGATACGCTTCCCGCTGGTTTCGACAAG
GCATCGCCCCTGGCTTTGCGACGCTACTTTCCCCGGAAGCGTCAGGCCTTGGTGTCTGTCGTGAAGCGCGTAACG
AAGACCCGCGATGGAATCCGACTTCTCAAGTCTTTCTCGGCCTTCTTCGTCGCCTATGTCCTGTGCCTCTTGCCC
GTCATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCCAGATCA
TTGGGATCCCAGCTCGACGGTGCGATCCTCACCATTGTGGGTGCCGCCTGTGGACTGGCCTGGGGCGTGCTTGGC
TTGCTTCTGTCCGAGTCTTCGGTAGCTGCACGGGCTGGTTACGCGGGTGTCTTGGCTGTTTGGATGGCTCTGTTC
ATGACGTCCATCTCCCTCACTCGAGCCTTCTTCATACGATTCTATCAGGCTATACACTCGGCCGGTCTCGCCGTC
GTCTTTGCCACGCTGGCCGAGACGGGCAGCCGCCAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTGCCTGG
TTGTTCGGACAGGCCATTGCCTTGCTGATAAACTGCGTCATCTTCCCGGATGCCGGCGCGAGAGATCTGGCGACG
ACGTTTCACGCCGCTTTCGATGTGATGCTGGAGGCTCTCGATGCCTCGTCACGTCGAGACCGTCGACTCCGCCGG
CGTCTGTCGCGAGCGTTTGTTGACTTATCACAAGCATGTCGCGACATGAAGATCGATATCACCGTTACGCGCGTC
CGACCCAGTGACGTCGGGGACCTTCGCAACCTGATGCAGGCCGTTATCCGCGCTCTCCTCACTCTCAAGGCCGAC
ACTTGTCTGTTCAAGCACTCGCCCTCGGAACACGACGTCAGCATTACCGTCGACGAGCCTGGTCTGAGCATCCTG
GAAGCGGCCGTGACGGCGGCTTCGTCTCCGGACCACAGCAGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAG
AACATGCTCTCCTGCATGTCCCGATGCGTGCGAATCTGCGACGCTATCCTGATGGACCTGAGCGGACATCGTCGA
GGCTTAGGTCCCGCGCCGGACGTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCCGCC
TACGATGTCGTCGAGGCCAGTCTCATCGATTCGGAAGAGCGGCTACCGGAGTCTTCGATTCAGGATGGTGATGTC
GTCCAGCTCTTCGTCTTTGCTCGTCACGTCCGAGAGGCCTCGTCTACCATTGAGCATCTGGTAGACAAAGTCCAG
GAAGTGCAGCAGACGTCTTCCGGCTGGCCTCGTCCCCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATCGG
ACCAACGCCCAAACACGTCATGATCGTGGGGGGGTCACGGCCGGCTCATACCACGTCACTTTCGAGGAGATAGGT
CGCTTACTCGAGAAGATGAAGTCGAATGACCACGAGCCGATTCGACGAACAGACAGCCTCTGTCTGGATACCGTG
GCCTCACGCGTCTCGCCAGACACTACCGCCAGTCCAGCCAAGACGAGCCGCGCACGATACAAGGTCTGGCGCGTC
CTCAAACGTCTGCAGGGCTTCGAGAGCAGATACGCCTTCAAGGTCTGTCTCGTGACTACCCTGCTGGCCATCCCG
GCCTATCTGGTCCGGGACCGCGGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGGCTGGCC
ATGCACCCCCGAGTCGGAGGCAACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCCATCCTGGGCGCCGCCTGG
AGCGCGGCGGCGTATGTCGTCGGCAATGGCAACCCATACGTCATGGCAGTTTTTGCCACGGTCTACATGGTGCCC
ATGCTGCTTCGCTTCACGCAGAGTTCGCACCCGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTCATCTCG
CTTCGACTGATGGTGGAAAGCAACGACACGTCCCCTACTCTGCTGGCCACATACAGCGGCGTGGCATTCTTAGTT
GGCGCCACGGTTCCTGTCATGGTCAACTGGGTGTTGTGGCCGTTTGTCGCCAGACACGAGTTGAGGCGGGCTCTC
TCGTCCATGATGTTCTTTATGAGCGTCATCTACCGAAGCGTGGTGGCGAGATACGTCTACTTCCACGAGGGTAAA
GAACCAACACCAGAAGACGTACAGAGATCCGAAATGCTAGAAGGCCGCCTCAGAGAAGGCTTCGTCCGCATAAGA
CAACTCCTAGTCCTCACCCAGAAAGAAATCCGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCCCTCGCC
GACTCCTGCGAACGCTTCTTCGATTACCTCGTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGATTACATC
CGCGACAACCCACAAGCAGCAGAACAGCTCCTAAGCCACCGCCGCGACGCCGTAGCCGCCATCCTGGGAAACCTG
TACATCCTCGCCGGCGCCCTCCGTTCCAAGCGCAAAGTCCCCCGTTATCTACCCAACGCAGCCGCCGCTCGGAGA
AGGTTGCTCATGATGAACGCCCAAGTCGACGACGAAACGTCCCGTCTTTCCCCCTCCGCGGACGCAGCATGCCAC
AAACGCTGGAGCGACATCTACCGCTACTCGTATAACGAGAGTCTGGTGGGTTGCGTCGCGCAGCTGGATGAGCTG
GAGAAGCTCACCAAGCTCATCGTCGGCGAGCAGCGATCTGGCGAGTTCGAGGTTTAG
Gene >Ophcf2|01454
ATGTCCCATCAGTCTTCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAAGCTGCGGCCCGTGCCAGCTCCCGAT
GCCTTCCTCGAGCCCGTCTCCCCTCCGCCGATAAGCCGGCCGAGTTCTACTCATAGCCTTGTCCAGTTGGACCAC
ATGGTCTCGGACAAGATAGACACGGAGACGTACGGAGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTC
CTCAGACCGTCGCACGTGTTTGCCGCCGACCTGTTGCAAGATTCTGCCGATACGCTTCCCGCTGGTTTCGACAAG
GCATCGCCCCTGGCTTTGCGACGCTACTTTCCCCGGAAGCGTCAGGCCTTGGTGTCTGTCGTGAAGCGCGTAACG
AAGACCCGCGATGGAATCCGACTTCTCAAGTCTTTCTCGGCCTTCTTCGTCGCCTATGTCCTGTGCCTCTTGCCC
GTCATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCCAGATCA
TTGGGATCCCAGCTCGACGGTGCGATCCTCACCATTGTGGGTGCCGCCTGTGGACTGGCCTGGGGCGTGCTTGGC
TTGCTTCTGTCCGAGTCTTCGGTAGCTGCACGGGCTGGTTACGCGGGTGTCTTGGCTGTTTGGATGGCTCTGTTC
ATGACGTCCATCTCCCTCACTCGAGCCTTCTTCATACGATTCTATCAGGCTATACACTCGGCCGGTCTCGCCGTC
GTCTTTGCCACGCTGGCCGAGACGGGCAGCCGCCAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTGCCTGG
TTGTTCGGACAGGCCATTGCCTTGCTGATAAACTGCGTCATCTTCCCGGATGCCGGCGCGAGAGATCTGGCGACG
ACGTTTCACGCCGCTTTCGATGTGATGCTGGTATGTTTCCCCCCTGTCACTATCAATCGCAACACAGCTGCTGAT
GTGCCGCAGGAGGCTCTCGATGCCTCGTCACGTCGAGACCGTCGACTCCGCCGGCGTCTGTCGCGAGCGTTTGTT
GACTTATCACAAGCATGTCGCGACATGAAGATCGATATCACCGTTACGCGCGTCCGACCCAGTGACGTCGGGGAC
CTTCGCAACCTGATGCAGGCCGTTATCCGCGCTCTCCTCACTCTCAAGGCCGACACTTGTCTGTTCAAGCACTCG
CCCTCGGAACACGACGTCAGCATTACCGTCGACGAGCCTGGTCTGAGCATCCTGGAAGCGGCCGTGACGGCGGCT
TCGTCTCCGGACCACAGCAGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAGAACATGCTCTCCTGCATGTCC
CGATGCGTGCGAATCTGCGACGCTATCCTGATGGACCTGAGCGGACATCGTCGAGGCTTAGGTCCCGCGCCGGAC
GTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCCGCCTACGATGTCGTCGAGGCCAGT
CTCATCGATTCGGAAGAGCGGCTACCGGAGTCTTCGATTCAGGATGGTGATGTCGTCCAGCTCTTCGTCTTTGCT
CGTCACGTCCGAGAGGCCTCGTCTACCATTGAGCATCTGGTAGACAAAGTCCAGGAAGTGCAGCAGACGTCTTCC
GGCTGGCCTCGTCCCCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATCGGACCAACGCCCAAACACGTCAT
GATCGTGGGGGGGTCACGGCCGGCTCATACCACGTCACTTTCGAGGAGATAGGTCGCTTACTCGAGAAGATGAAG
TCGAATGACCACGAGCCGATTCGACGAACAGACAGCCTCTGTCTGGATACCGTGGCCTCACGCGTCTCGCCAGAC
ACTACCGCCAGTCCAGCCAAGACGAGCCGCGCACGATACAAGGTCTGGCGCGTCCTCAAACGTCTGCAGGGCTTC
GAGAGCAGATACGCCTTCAAGGTCTGTCTCGTGACTACCCTGCTGGCCATCCCGGCCTATCTGGTCCGGGACCGC
GGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGGCTGGCCATGCACCCCCGAGTCGGAGGC
AACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCCATCCTGGGCGCCGCCTGGAGCGCGGCGGCGTATGTCGTC
GGCAATGGCAACCCATACGTCATGGCAGTTTTTGCCACGGTCTACATGGTGCCCATGCTGCTTCGCTTCACGCAG
AGTTCGCACCCGGTAAGTTGCAAGCCTTCGCCTTGGTGGTTACCGCGGGCCAACCAACTGACGTCTTTCCGTTTG
TTGGATAAGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTCATCTCGCTTCGACTGATGGTGGAAAGCAAC
GACACGTCCCCTACTCTGCTGGCCACATACAGCGGCGTGGCATTCTTAGTTGGCGCCACGGTTCCTGTCATGGTC
AACTGGGTGTTGTGGCCGTTTGTCGCCAGACACGAGTTGAGGCGGGCTCTCTCGTCCATGATGTTCTTTATGAGC
GTCATCTACCGAAGTGAGTAGTCTCTTTAGAGCACTCTCTCATCCATCTACTTGCTCCGAGGGTGCTGACCCCTT
TTTCACTCAGGCGTGGTGGCGAGATACGTCTACTTCCACGAGGGTAAAGAACCAACACCAGAAGACGTACAGAGA
TCCGAAATGCTAGAAGGCCGCCTCAGAGAAGGCTTCGTCCGCATAAGACAACTCCTAGTGAGCAGTCCCCAACCC
TCATAACCCCCCCCCTCCCCCCCCCCTCTCGCTCACCCCCCTTTCCCCTCTCAGGTCCTCACCCAGAAAGAAATC
CGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCCCTCGCCGACTCCTGCGAACGCTTCTTCGATTACCTC
GTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGATTACATCCGCGACAACCCACAAGCAGCAGAACAGCTC
CTAAGCCACCGCCGCGACGCCGTAGCCGCCATCCTGGGAAACCTGTACATCCTCGCCGGCGCCCTCCGTTCCAAG
CGCAAAGTCCCCGTCCGTCTTTCCCTTCCCCCCCCCCCCCCTTTCCCTTCTCTATCCTCGTGCAAGATGATGTCG
GGGCTGACCTGACGCAGCGTTATCTACCCAACGCAGCCGCCGCTCGGAGAAGGTTGCTCATGATGAACGCCCAAG
TCGACGACGAAACGTCCCGTCTTTCCCCCTCCGCGGACGCAGCATGCCACAAACGCTGGAGCGACATCTACCGCT
ACTCGTATAACGAGAGTCTGGTGGGTTGCGTCGCGCAGCTGGATGAGCTGGAGAAGCTCACCAAGCTCATCGTCG
GCGAGCAGCGGTCAGTTTTCTTTCTTTTTTTTTCTTTCTATTCTTTTTTCCCTCTCCCCCCCTTTTGTTTGAACC
CTCTGTTTTCTCCCTTCTGTATTCAGGGTTCGCTGATGGAGATTGGTGGGCTAGATCTGGCGAGTTCGAGGTTTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail