Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01454
Gene name
Locationscaffold_01:5045232..5048758
Strand-
Gene length (bp)3526
Transcript length (bp)3057
Coding sequence length (bp)3057
Protein length (aa) 1019

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 1.8E-07 661 779
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 3.6E-06 131 204

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 130 152 22
2 182 204 22
3 234 256 22
4 271 290 19
5 687 709 22
6 714 731 17
7 738 755 17
8 770 792 22
9 799 821 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01454
MSHQSSDVLRRRQQPLKLRPVPAPDAFLEPVSPPPISRPSSTHSLVQLDHMVSDKIDTETYGVSELRDGFFDAMF
LRPSHVFAADLLQDSADTLPAGFDKASPLALRRYFPRKRQALVSVVKRVTKTRDGIRLLKSFSAFFVAYVLCLLP
VIRNWLGRYHYIMAVSVIVNHPARSLGSQLDGAILTIVGAACGLAWGVLGLLLSESSVAARAGYAGVLAVWMALF
MTSISLTRAFFIRFYQAIHSAGLAVVFATLAETGSRQAEWTKLRDYGFAWLFGQAIALLINCVIFPDAGARDLAT
TFHAAFDVMLEALDASSRRDRRLRRRLSRAFVDLSQACRDMKIDITVTRVRPSDVGDLRNLMQAVIRALLTLKAD
TCLFKHSPSEHDVSITVDEPGLSILEAAVTAASSPDHSSRAIEELGDRTKNMLSCMSRCVRICDAILMDLSGHRR
GLGPAPDVPSDLQPAIRKLGQAKAAYDVVEASLIDSEERLPESSIQDGDVVQLFVFARHVREASSTIEHLVDKVQ
EVQQTSSGWPRPHLPSYPFWKALHRTNAQTRHDRGGVTAGSYHVTFEEIGRLLEKMKSNDHEPIRRTDSLCLDTV
ASRVSPDTTASPAKTSRARYKVWRVLKRLQGFESRYAFKVCLVTTLLAIPAYLVRDRGWWEDYECWWAVSISWLA
MHPRVGGNVQDLFIRGFMAILGAAWSAAAYVVGNGNPYVMAVFATVYMVPMLLRFTQSSHPRSGLIGCLSFTVIS
LRLMVESNDTSPTLLATYSGVAFLVGATVPVMVNWVLWPFVARHELRRALSSMMFFMSVIYRSVVARYVYFHEGK
EPTPEDVQRSEMLEGRLREGFVRIRQLLVLTQKEIRLRAPFDPLPYSALADSCERFFDYLVAVRQSALFYNPDYI
RDNPQAAEQLLSHRRDAVAAILGNLYILAGALRSKRKVPRYLPNAAAARRRLLMMNAQVDDETSRLSPSADAACH
KRWSDIYRYSYNESLVGCVAQLDELEKLTKLIVGEQRSGEFEV*
Coding >Ophcf2|01454
ATGTCCCATCAGTCTTCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAAGCTGCGGCCCGTGCCAGCTCCCGAT
GCCTTCCTCGAGCCCGTCTCCCCTCCGCCGATAAGCCGGCCGAGTTCTACTCATAGCCTTGTCCAGTTGGACCAC
ATGGTCTCGGACAAGATAGACACGGAGACGTACGGAGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTC
CTCAGACCGTCGCACGTGTTTGCCGCCGACCTGTTGCAAGATTCTGCCGATACGCTTCCCGCTGGTTTCGACAAG
GCATCGCCCCTGGCTTTGCGACGCTACTTTCCCCGGAAGCGTCAGGCCTTGGTGTCTGTCGTGAAGCGCGTAACG
AAGACCCGCGATGGAATCCGACTTCTCAAGTCTTTCTCGGCCTTCTTCGTCGCCTATGTCCTGTGCCTCTTGCCC
GTCATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCCAGATCA
TTGGGATCCCAGCTCGACGGTGCGATCCTCACCATTGTGGGTGCCGCCTGTGGACTGGCCTGGGGCGTGCTTGGC
TTGCTTCTGTCCGAGTCTTCGGTAGCTGCACGGGCTGGTTACGCGGGTGTCTTGGCTGTTTGGATGGCTCTGTTC
ATGACGTCCATCTCCCTCACTCGAGCCTTCTTCATACGATTCTATCAGGCTATACACTCGGCCGGTCTCGCCGTC
GTCTTTGCCACGCTGGCCGAGACGGGCAGCCGCCAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTGCCTGG
TTGTTCGGACAGGCCATTGCCTTGCTGATAAACTGCGTCATCTTCCCGGATGCCGGCGCGAGAGATCTGGCGACG
ACGTTTCACGCCGCTTTCGATGTGATGCTGGAGGCTCTCGATGCCTCGTCACGTCGAGACCGTCGACTCCGCCGG
CGTCTGTCGCGAGCGTTTGTTGACTTATCACAAGCATGTCGCGACATGAAGATCGATATCACCGTTACGCGCGTC
CGACCCAGTGACGTCGGGGACCTTCGCAACCTGATGCAGGCCGTTATCCGCGCTCTCCTCACTCTCAAGGCCGAC
ACTTGTCTGTTCAAGCACTCGCCCTCGGAACACGACGTCAGCATTACCGTCGACGAGCCTGGTCTGAGCATCCTG
GAAGCGGCCGTGACGGCGGCTTCGTCTCCGGACCACAGCAGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAG
AACATGCTCTCCTGCATGTCCCGATGCGTGCGAATCTGCGACGCTATCCTGATGGACCTGAGCGGACATCGTCGA
GGCTTAGGTCCCGCGCCGGACGTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCCGCC
TACGATGTCGTCGAGGCCAGTCTCATCGATTCGGAAGAGCGGCTACCGGAGTCTTCGATTCAGGATGGTGATGTC
GTCCAGCTCTTCGTCTTTGCTCGTCACGTCCGAGAGGCCTCGTCTACCATTGAGCATCTGGTAGACAAAGTCCAG
GAAGTGCAGCAGACGTCTTCCGGCTGGCCTCGTCCCCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATCGG
ACCAACGCCCAAACACGTCATGATCGTGGGGGGGTCACGGCCGGCTCATACCACGTCACTTTCGAGGAGATAGGT
CGCTTACTCGAGAAGATGAAGTCGAATGACCACGAGCCGATTCGACGAACAGACAGCCTCTGTCTGGATACCGTG
GCCTCACGCGTCTCGCCAGACACTACCGCCAGTCCAGCCAAGACGAGCCGCGCACGATACAAGGTCTGGCGCGTC
CTCAAACGTCTGCAGGGCTTCGAGAGCAGATACGCCTTCAAGGTCTGTCTCGTGACTACCCTGCTGGCCATCCCG
GCCTATCTGGTCCGGGACCGCGGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGGCTGGCC
ATGCACCCCCGAGTCGGAGGCAACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCCATCCTGGGCGCCGCCTGG
AGCGCGGCGGCGTATGTCGTCGGCAATGGCAACCCATACGTCATGGCAGTTTTTGCCACGGTCTACATGGTGCCC
ATGCTGCTTCGCTTCACGCAGAGTTCGCACCCGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTCATCTCG
CTTCGACTGATGGTGGAAAGCAACGACACGTCCCCTACTCTGCTGGCCACATACAGCGGCGTGGCATTCTTAGTT
GGCGCCACGGTTCCTGTCATGGTCAACTGGGTGTTGTGGCCGTTTGTCGCCAGACACGAGTTGAGGCGGGCTCTC
TCGTCCATGATGTTCTTTATGAGCGTCATCTACCGAAGCGTGGTGGCGAGATACGTCTACTTCCACGAGGGTAAA
GAACCAACACCAGAAGACGTACAGAGATCCGAAATGCTAGAAGGCCGCCTCAGAGAAGGCTTCGTCCGCATAAGA
CAACTCCTAGTCCTCACCCAGAAAGAAATCCGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCCCTCGCC
GACTCCTGCGAACGCTTCTTCGATTACCTCGTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGATTACATC
CGCGACAACCCACAAGCAGCAGAACAGCTCCTAAGCCACCGCCGCGACGCCGTAGCCGCCATCCTGGGAAACCTG
TACATCCTCGCCGGCGCCCTCCGTTCCAAGCGCAAAGTCCCCCGTTATCTACCCAACGCAGCCGCCGCTCGGAGA
AGGTTGCTCATGATGAACGCCCAAGTCGACGACGAAACGTCCCGTCTTTCCCCCTCCGCGGACGCAGCATGCCAC
AAACGCTGGAGCGACATCTACCGCTACTCGTATAACGAGAGTCTGGTGGGTTGCGTCGCGCAGCTGGATGAGCTG
GAGAAGCTCACCAAGCTCATCGTCGGCGAGCAGCGATCTGGCGAGTTCGAGGTTTAG
Transcript >Ophcf2|01454
ATGTCCCATCAGTCTTCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAAGCTGCGGCCCGTGCCAGCTCCCGAT
GCCTTCCTCGAGCCCGTCTCCCCTCCGCCGATAAGCCGGCCGAGTTCTACTCATAGCCTTGTCCAGTTGGACCAC
ATGGTCTCGGACAAGATAGACACGGAGACGTACGGAGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTC
CTCAGACCGTCGCACGTGTTTGCCGCCGACCTGTTGCAAGATTCTGCCGATACGCTTCCCGCTGGTTTCGACAAG
GCATCGCCCCTGGCTTTGCGACGCTACTTTCCCCGGAAGCGTCAGGCCTTGGTGTCTGTCGTGAAGCGCGTAACG
AAGACCCGCGATGGAATCCGACTTCTCAAGTCTTTCTCGGCCTTCTTCGTCGCCTATGTCCTGTGCCTCTTGCCC
GTCATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCCAGATCA
TTGGGATCCCAGCTCGACGGTGCGATCCTCACCATTGTGGGTGCCGCCTGTGGACTGGCCTGGGGCGTGCTTGGC
TTGCTTCTGTCCGAGTCTTCGGTAGCTGCACGGGCTGGTTACGCGGGTGTCTTGGCTGTTTGGATGGCTCTGTTC
ATGACGTCCATCTCCCTCACTCGAGCCTTCTTCATACGATTCTATCAGGCTATACACTCGGCCGGTCTCGCCGTC
GTCTTTGCCACGCTGGCCGAGACGGGCAGCCGCCAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTGCCTGG
TTGTTCGGACAGGCCATTGCCTTGCTGATAAACTGCGTCATCTTCCCGGATGCCGGCGCGAGAGATCTGGCGACG
ACGTTTCACGCCGCTTTCGATGTGATGCTGGAGGCTCTCGATGCCTCGTCACGTCGAGACCGTCGACTCCGCCGG
CGTCTGTCGCGAGCGTTTGTTGACTTATCACAAGCATGTCGCGACATGAAGATCGATATCACCGTTACGCGCGTC
CGACCCAGTGACGTCGGGGACCTTCGCAACCTGATGCAGGCCGTTATCCGCGCTCTCCTCACTCTCAAGGCCGAC
ACTTGTCTGTTCAAGCACTCGCCCTCGGAACACGACGTCAGCATTACCGTCGACGAGCCTGGTCTGAGCATCCTG
GAAGCGGCCGTGACGGCGGCTTCGTCTCCGGACCACAGCAGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAG
AACATGCTCTCCTGCATGTCCCGATGCGTGCGAATCTGCGACGCTATCCTGATGGACCTGAGCGGACATCGTCGA
GGCTTAGGTCCCGCGCCGGACGTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCCGCC
TACGATGTCGTCGAGGCCAGTCTCATCGATTCGGAAGAGCGGCTACCGGAGTCTTCGATTCAGGATGGTGATGTC
GTCCAGCTCTTCGTCTTTGCTCGTCACGTCCGAGAGGCCTCGTCTACCATTGAGCATCTGGTAGACAAAGTCCAG
GAAGTGCAGCAGACGTCTTCCGGCTGGCCTCGTCCCCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATCGG
ACCAACGCCCAAACACGTCATGATCGTGGGGGGGTCACGGCCGGCTCATACCACGTCACTTTCGAGGAGATAGGT
CGCTTACTCGAGAAGATGAAGTCGAATGACCACGAGCCGATTCGACGAACAGACAGCCTCTGTCTGGATACCGTG
GCCTCACGCGTCTCGCCAGACACTACCGCCAGTCCAGCCAAGACGAGCCGCGCACGATACAAGGTCTGGCGCGTC
CTCAAACGTCTGCAGGGCTTCGAGAGCAGATACGCCTTCAAGGTCTGTCTCGTGACTACCCTGCTGGCCATCCCG
GCCTATCTGGTCCGGGACCGCGGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGGCTGGCC
ATGCACCCCCGAGTCGGAGGCAACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCCATCCTGGGCGCCGCCTGG
AGCGCGGCGGCGTATGTCGTCGGCAATGGCAACCCATACGTCATGGCAGTTTTTGCCACGGTCTACATGGTGCCC
ATGCTGCTTCGCTTCACGCAGAGTTCGCACCCGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTCATCTCG
CTTCGACTGATGGTGGAAAGCAACGACACGTCCCCTACTCTGCTGGCCACATACAGCGGCGTGGCATTCTTAGTT
GGCGCCACGGTTCCTGTCATGGTCAACTGGGTGTTGTGGCCGTTTGTCGCCAGACACGAGTTGAGGCGGGCTCTC
TCGTCCATGATGTTCTTTATGAGCGTCATCTACCGAAGCGTGGTGGCGAGATACGTCTACTTCCACGAGGGTAAA
GAACCAACACCAGAAGACGTACAGAGATCCGAAATGCTAGAAGGCCGCCTCAGAGAAGGCTTCGTCCGCATAAGA
CAACTCCTAGTCCTCACCCAGAAAGAAATCCGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCCCTCGCC
GACTCCTGCGAACGCTTCTTCGATTACCTCGTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGATTACATC
CGCGACAACCCACAAGCAGCAGAACAGCTCCTAAGCCACCGCCGCGACGCCGTAGCCGCCATCCTGGGAAACCTG
TACATCCTCGCCGGCGCCCTCCGTTCCAAGCGCAAAGTCCCCCGTTATCTACCCAACGCAGCCGCCGCTCGGAGA
AGGTTGCTCATGATGAACGCCCAAGTCGACGACGAAACGTCCCGTCTTTCCCCCTCCGCGGACGCAGCATGCCAC
AAACGCTGGAGCGACATCTACCGCTACTCGTATAACGAGAGTCTGGTGGGTTGCGTCGCGCAGCTGGATGAGCTG
GAGAAGCTCACCAAGCTCATCGTCGGCGAGCAGCGATCTGGCGAGTTCGAGGTTTAG
Gene >Ophcf2|01454
ATGTCCCATCAGTCTTCAGACGTGCTTCGACGGCGGCAGCAACCGCTTAAGCTGCGGCCCGTGCCAGCTCCCGAT
GCCTTCCTCGAGCCCGTCTCCCCTCCGCCGATAAGCCGGCCGAGTTCTACTCATAGCCTTGTCCAGTTGGACCAC
ATGGTCTCGGACAAGATAGACACGGAGACGTACGGAGTGTCGGAGCTTCGAGATGGCTTCTTCGATGCCATGTTC
CTCAGACCGTCGCACGTGTTTGCCGCCGACCTGTTGCAAGATTCTGCCGATACGCTTCCCGCTGGTTTCGACAAG
GCATCGCCCCTGGCTTTGCGACGCTACTTTCCCCGGAAGCGTCAGGCCTTGGTGTCTGTCGTGAAGCGCGTAACG
AAGACCCGCGATGGAATCCGACTTCTCAAGTCTTTCTCGGCCTTCTTCGTCGCCTATGTCCTGTGCCTCTTGCCC
GTCATCCGCAACTGGCTCGGCCGCTATCACTACATCATGGCCGTCTCCGTCATCGTCAACCATCCGGCCAGATCA
TTGGGATCCCAGCTCGACGGTGCGATCCTCACCATTGTGGGTGCCGCCTGTGGACTGGCCTGGGGCGTGCTTGGC
TTGCTTCTGTCCGAGTCTTCGGTAGCTGCACGGGCTGGTTACGCGGGTGTCTTGGCTGTTTGGATGGCTCTGTTC
ATGACGTCCATCTCCCTCACTCGAGCCTTCTTCATACGATTCTATCAGGCTATACACTCGGCCGGTCTCGCCGTC
GTCTTTGCCACGCTGGCCGAGACGGGCAGCCGCCAGGCTGAATGGACCAAGCTGCGCGACTACGGCTTTGCCTGG
TTGTTCGGACAGGCCATTGCCTTGCTGATAAACTGCGTCATCTTCCCGGATGCCGGCGCGAGAGATCTGGCGACG
ACGTTTCACGCCGCTTTCGATGTGATGCTGGTATGTTTCCCCCCTGTCACTATCAATCGCAACACAGCTGCTGAT
GTGCCGCAGGAGGCTCTCGATGCCTCGTCACGTCGAGACCGTCGACTCCGCCGGCGTCTGTCGCGAGCGTTTGTT
GACTTATCACAAGCATGTCGCGACATGAAGATCGATATCACCGTTACGCGCGTCCGACCCAGTGACGTCGGGGAC
CTTCGCAACCTGATGCAGGCCGTTATCCGCGCTCTCCTCACTCTCAAGGCCGACACTTGTCTGTTCAAGCACTCG
CCCTCGGAACACGACGTCAGCATTACCGTCGACGAGCCTGGTCTGAGCATCCTGGAAGCGGCCGTGACGGCGGCT
TCGTCTCCGGACCACAGCAGCCGAGCCATCGAGGAGCTGGGCGATCGGACAAAGAACATGCTCTCCTGCATGTCC
CGATGCGTGCGAATCTGCGACGCTATCCTGATGGACCTGAGCGGACATCGTCGAGGCTTAGGTCCCGCGCCGGAC
GTGCCGTCTGATCTGCAACCCGCGATCCGGAAGCTCGGACAAGCAAAGGCCGCCTACGATGTCGTCGAGGCCAGT
CTCATCGATTCGGAAGAGCGGCTACCGGAGTCTTCGATTCAGGATGGTGATGTCGTCCAGCTCTTCGTCTTTGCT
CGTCACGTCCGAGAGGCCTCGTCTACCATTGAGCATCTGGTAGACAAAGTCCAGGAAGTGCAGCAGACGTCTTCC
GGCTGGCCTCGTCCCCATCTACCGTCGTACCCCTTTTGGAAAGCCCTTCATCGGACCAACGCCCAAACACGTCAT
GATCGTGGGGGGGTCACGGCCGGCTCATACCACGTCACTTTCGAGGAGATAGGTCGCTTACTCGAGAAGATGAAG
TCGAATGACCACGAGCCGATTCGACGAACAGACAGCCTCTGTCTGGATACCGTGGCCTCACGCGTCTCGCCAGAC
ACTACCGCCAGTCCAGCCAAGACGAGCCGCGCACGATACAAGGTCTGGCGCGTCCTCAAACGTCTGCAGGGCTTC
GAGAGCAGATACGCCTTCAAGGTCTGTCTCGTGACTACCCTGCTGGCCATCCCGGCCTATCTGGTCCGGGACCGC
GGCTGGTGGGAAGACTATGAATGCTGGTGGGCCGTCTCCATCAGCTGGCTGGCCATGCACCCCCGAGTCGGAGGC
AACGTCCAGGACCTCTTCATCAGGGGCTTCATGGCCATCCTGGGCGCCGCCTGGAGCGCGGCGGCGTATGTCGTC
GGCAATGGCAACCCATACGTCATGGCAGTTTTTGCCACGGTCTACATGGTGCCCATGCTGCTTCGCTTCACGCAG
AGTTCGCACCCGGTAAGTTGCAAGCCTTCGCCTTGGTGGTTACCGCGGGCCAACCAACTGACGTCTTTCCGTTTG
TTGGATAAGCGGTCCGGCCTCATCGGCTGTCTCTCCTTCACCGTCATCTCGCTTCGACTGATGGTGGAAAGCAAC
GACACGTCCCCTACTCTGCTGGCCACATACAGCGGCGTGGCATTCTTAGTTGGCGCCACGGTTCCTGTCATGGTC
AACTGGGTGTTGTGGCCGTTTGTCGCCAGACACGAGTTGAGGCGGGCTCTCTCGTCCATGATGTTCTTTATGAGC
GTCATCTACCGAAGTGAGTAGTCTCTTTAGAGCACTCTCTCATCCATCTACTTGCTCCGAGGGTGCTGACCCCTT
TTTCACTCAGGCGTGGTGGCGAGATACGTCTACTTCCACGAGGGTAAAGAACCAACACCAGAAGACGTACAGAGA
TCCGAAATGCTAGAAGGCCGCCTCAGAGAAGGCTTCGTCCGCATAAGACAACTCCTAGTGAGCAGTCCCCAACCC
TCATAACCCCCCCCCTCCCCCCCCCCTCTCGCTCACCCCCCTTTCCCCTCTCAGGTCCTCACCCAGAAAGAAATC
CGCCTCCGCGCCCCCTTCGATCCCCTCCCCTACTCCGCCCTCGCCGACTCCTGCGAACGCTTCTTCGATTACCTC
GTCGCCGTCCGCCAGTCAGCCCTCTTCTACAACCCAGATTACATCCGCGACAACCCACAAGCAGCAGAACAGCTC
CTAAGCCACCGCCGCGACGCCGTAGCCGCCATCCTGGGAAACCTGTACATCCTCGCCGGCGCCCTCCGTTCCAAG
CGCAAAGTCCCCGTCCGTCTTTCCCTTCCCCCCCCCCCCCCTTTCCCTTCTCTATCCTCGTGCAAGATGATGTCG
GGGCTGACCTGACGCAGCGTTATCTACCCAACGCAGCCGCCGCTCGGAGAAGGTTGCTCATGATGAACGCCCAAG
TCGACGACGAAACGTCCCGTCTTTCCCCCTCCGCGGACGCAGCATGCCACAAACGCTGGAGCGACATCTACCGCT
ACTCGTATAACGAGAGTCTGGTGGGTTGCGTCGCGCAGCTGGATGAGCTGGAGAAGCTCACCAAGCTCATCGTCG
GCGAGCAGCGGTCAGTTTTCTTTCTTTTTTTTTCTTTCTATTCTTTTTTCCCTCTCCCCCCCTTTTGTTTGAACC
CTCTGTTTTCTCCCTTCTGTATTCAGGGTTCGCTGATGGAGATTGGTGGGCTAGATCTGGCGAGTTCGAGGTTTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail