Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01453
Gene name
Locationscaffold_01:5039961..5044834
Strand+
Gene length (bp)4873
Transcript length (bp)4662
Coding sequence length (bp)4662
Protein length (aa) 1554

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08696 Dna2 DNA replication factor Dna2 1.3E-67 477 678
PF13087 AAA_12 AAA domain 2.1E-49 1215 1443
PF13086 AAA_11 AAA domain 4.2E-13 1039 1126
PF13086 AAA_11 AAA domain 5.0E-15 1144 1206
PF13604 AAA_30 AAA domain 2.6E-16 1038 1246
PF13245 AAA_19 AAA domain 7.7E-12 1043 1205
PF01930 Cas_Cas4 Domain of unknown function DUF83 3.1E-08 686 789

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0140657 ATP-dependent activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.359 0.8372 0.15 0.0189 0.1685 0.0678 0.0189 0.0242 0.0277 0.0304

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6507
Ophiocordyceps australis map64 (Brazil) OphauB2|1563
Ophiocordyceps camponoti-floridani Ophcf2|01453 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1738
Ophiocordyceps kimflemingae Ophio5|4257
Ophiocordyceps subramaniannii Hirsu2|2660

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01453
MPLHKSHSERLGLRKSRQPWQRSSSHPVDLQTPKSKPLLPVSEVTKDKLSRFQYHPGEADSTRQDAGQTSPWTAN
DDTSAGQTRLNWRDLMDPGVAAEDDTDTSPSDKVLWNNKQDSLYVSALSPMLARKRKRARSSSPISSPLADKPEP
PTVDVGMLREALKLGHADPTMELWDRYSYSLNGPENAKSSPGVVKPALDQLMISSSPKPRGDDSALKTDFGLRRA
MMCGLSWPKRRKNSKTERVRVSDEHQELGSLTKKPSLVTELLDTVDQGLEEACVQPEQDESPSLNKRRLPPNPHS
SPCRAVAGGGVVADLPCSDYGDDDFDDDTLTELEASLIAGDGTKALSNTNQGMNEASTANDDDIELVDDGSSNLD
QQVTRGSDAPKTPPGRPQNKGAQKSPGDEFEDDFDADIDFDAVELAATQTVQQRRDVPPATKTEPKAKVIQRYLV
TSVVEGDYIDELGHTRPEKMLIIQADGSKAARTVHLRGAWFDTPAHTESYVHVIGKFSAKGQCFVDDAQNLLILH
PDQLLSATVVADSFGCMRRAVLQDRVKATSEATPPLVYGTILHEIFQEALLANSWDLAFLSGVINRKVEEHVEDL
YRIRIGIAAATEHLLSKMTELSYWAKAFVSAAPKTDAVVEDRNGKTAAMAVRKLLDVEEHVWSPMYGLKGNIDAT
VEVVMADGKEKRTLTVPFELKTGRQANSSHMAQTALYTLLLADRYDIDIAYGILYYMETSKTMRIPAVRHELRHM
IMQRNQLACHIRERSVKLPPMLKNKHVCGRCYAKTSCFIYHRLADEGDAESSGMKDKFDELVRHLTPAHRDFFVR
WENLLTKEEKESQKTKRELWTMTSSEREKKSRCFADVIIEQGSGSETASSGRINRFHYTFVKRLPQPKFSFLESE
LSTGEPVVVSDEEGHFALAIGYVTSVRKQRISVAVDRRLHNARIRQPGFDDKYNQVFASIMEVQPEAREEVPVQS
QPLRYRLDKDEFSNGMATVRNNLVQMMANDVPAAVKMRRLLVDLEAPRFKETSTQYGVAQGSTLNVDQERAIDKV
MRAQDYALVLGMPGTGKTTTIAHIIRALTSQGKSVLLTSHTHTAVDNILLKLEADDIPVLRLGAPAKIHAQVQGF
ARLAATTRKTFDDIRDAWHGTPVVATTCLGINHALFLERSFDYCIVDEASQITLPICAGPIRMASAFVLVGDHNQ
LPPVVRNSEARQGGLDVSLFKLLSDAHPESVVNLEHQYRMCEDIMTLSNTLIYDGRLRCGYEALRRRKLDVPALG
ALRNFHHGPASLLKRPTPRSFCTGPTPSRCWLYHLIEGEARVRFVNTDTIRPAVHEEAQGKRIVNRTEVRIVGQL
VDALLATGVAAEEVGVMTHYRAQLGLLHHRLRRHSGVEMHTTDRFQGRDKDVMVVSLVRCNEARNIGDLLRDWRR
INVAFTRARAKLLVIGSKSTLQQADNGMLGRFVALMESRDWVYDLPADAVEAHVFDDEAWSDQSSPSSPPPVEVA
ETGKKPSSSASADKENRRRGSPKKARVGARALLRGKPVLRDILADMMNGAEMR*
Coding >Ophcf2|01453
ATGCCGCTACATAAATCCCACTCTGAGCGTCTTGGGCTGCGGAAAAGCCGGCAGCCATGGCAACGGTCCAGCAGT
CACCCTGTCGACCTGCAGACTCCGAAATCGAAGCCTCTTCTGCCTGTGTCGGAGGTAACCAAGGACAAGCTCAGC
AGGTTTCAGTACCACCCCGGCGAGGCCGACTCGACGCGCCAAGATGCCGGACAAACCTCGCCTTGGACGGCCAAC
GATGACACTTCCGCGGGGCAGACCCGACTGAACTGGCGGGACCTCATGGATCCTGGCGTTGCGGCCGAGGACGAC
ACCGACACGTCGCCCAGCGACAAAGTCCTGTGGAACAACAAACAAGACTCGCTCTACGTCTCAGCACTGTCTCCC
ATGCTGGCTCGGAAGAGGAAGCGTGCCAGGAGCTCTTCGCCCATTTCGTCTCCGCTGGCAGACAAGCCCGAGCCG
CCAACCGTCGACGTCGGCATGTTGCGAGAGGCTCTGAAGCTGGGACACGCCGATCCGACGATGGAGCTGTGGGAT
CGCTACTCTTACTCGCTCAACGGGCCCGAGAACGCGAAGTCGTCGCCGGGCGTCGTGAAGCCGGCTCTCGACCAG
TTGATGATATCATCCTCTCCGAAGCCGCGCGGTGATGATTCGGCGCTCAAGACCGACTTTGGCTTGCGGCGCGCC
ATGATGTGTGGTCTGAGTTGGCCAAAGAGGCGGAAAAACTCCAAGACTGAGCGGGTTCGGGTGAGCGACGAACAT
CAAGAGTTAGGGTCTTTGACCAAAAAACCGTCGCTCGTCACAGAACTGCTCGACACAGTGGATCAGGGACTTGAA
GAGGCCTGTGTCCAGCCCGAGCAGGACGAGTCCCCGTCGCTCAACAAGCGAAGACTGCCTCCAAATCCTCACAGC
TCTCCGTGTCGGGCGGTCGCCGGTGGCGGTGTCGTTGCGGATCTACCTTGTTCGGACTACGGCGATGACGACTTC
GACGACGATACGCTTACGGAACTCGAGGCGAGTCTCATTGCCGGAGACGGGACGAAAGCGCTGTCAAATACGAAT
CAGGGGATGAACGAGGCGTCGACGGCAAACGATGATGACATTGAGCTCGTTGATGATGGCAGCTCGAATCTAGAC
CAGCAGGTCACACGCGGTTCAGATGCCCCTAAAACGCCTCCTGGGCGACCTCAGAACAAGGGGGCTCAGAAGAGC
CCCGGAGACGAGTTCGAAGACGATTTCGACGCGGACATTGACTTTGATGCCGTTGAGCTGGCAGCGACTCAAACA
GTGCAGCAGCGGCGCGATGTGCCTCCAGCGACCAAAACGGAACCAAAAGCCAAGGTCATCCAGCGATACTTAGTA
ACGAGTGTGGTAGAGGGCGACTACATCGATGAGCTGGGCCACACCCGGCCCGAGAAGATGCTCATCATCCAAGCC
GACGGCTCCAAGGCAGCTCGGACGGTTCATCTGAGGGGCGCCTGGTTCGATACGCCCGCGCACACCGAGTCGTAC
GTTCACGTCATCGGCAAATTCTCCGCCAAGGGACAGTGCTTCGTCGACGACGCTCAGAATCTGTTGATCTTGCAC
CCTGATCAGCTCCTGTCTGCCACCGTCGTCGCCGACTCCTTTGGCTGCATGCGCCGCGCCGTCCTTCAGGATCGG
GTCAAGGCCACGAGCGAAGCCACGCCGCCTCTCGTCTACGGGACCATACTTCATGAGATTTTTCAAGAGGCCCTG
CTCGCCAACAGCTGGGATCTCGCTTTTCTCTCAGGCGTTATCAACAGGAAAGTGGAGGAGCACGTGGAGGATCTC
TATCGCATCAGGATCGGCATCGCGGCCGCCACTGAGCATCTGCTTTCGAAGATGACTGAGCTGAGTTACTGGGCA
AAAGCGTTTGTTTCCGCGGCGCCCAAGACCGATGCGGTGGTTGAGGATCGAAACGGCAAGACGGCTGCCATGGCC
GTCAGGAAGCTACTCGATGTCGAGGAGCACGTCTGGTCTCCAATGTATGGACTGAAAGGGAATATCGACGCCACT
GTCGAGGTCGTCATGGCGGACGGAAAGGAGAAACGGACCCTCACGGTTCCGTTCGAGTTGAAGACGGGGAGACAA
GCGAACAGCAGCCATATGGCGCAGACGGCGCTCTACACCCTGCTTCTGGCGGATCGGTACGACATCGACATCGCC
TACGGCATCCTCTACTACATGGAGACTTCCAAGACGATGCGGATTCCGGCCGTACGGCATGAGCTGAGGCACATG
ATTATGCAGCGGAACCAGTTGGCCTGCCATATCCGAGAGCGAAGCGTCAAACTTCCTCCCATGCTCAAGAACAAG
CACGTGTGCGGAAGATGCTATGCCAAGACGTCTTGCTTCATATATCATCGACTGGCAGACGAGGGCGACGCCGAG
TCGAGTGGCATGAAGGACAAGTTTGACGAGCTCGTCCGGCACCTGACGCCTGCCCATCGGGACTTTTTCGTCCGG
TGGGAGAATCTCCTGACCAAGGAGGAAAAGGAGAGCCAGAAGACCAAGAGGGAGCTGTGGACGATGACGAGCTCA
GAGCGGGAGAAGAAGTCTCGATGCTTTGCCGACGTCATCATCGAACAAGGGTCCGGCTCGGAGACGGCATCCAGC
GGACGGATCAACCGGTTTCACTACACTTTCGTCAAGCGGCTTCCCCAGCCCAAGTTTTCGTTCCTCGAGTCGGAG
CTGTCGACGGGCGAGCCTGTCGTGGTATCGGACGAGGAGGGCCACTTTGCCTTGGCCATTGGCTACGTGACGTCG
GTCCGCAAGCAGAGGATCAGCGTCGCCGTCGACAGGCGTCTTCACAACGCCAGAATCAGGCAGCCCGGGTTTGAC
GACAAGTACAACCAGGTGTTTGCCAGCATCATGGAGGTGCAGCCGGAAGCGAGGGAGGAGGTTCCGGTCCAAAGT
CAGCCATTGCGGTACCGACTGGACAAGGACGAGTTCAGCAACGGCATGGCGACGGTCAGGAACAATCTGGTGCAG
ATGATGGCCAACGACGTGCCGGCGGCTGTCAAGATGAGGAGGCTGCTCGTCGACCTGGAGGCGCCTCGGTTCAAG
GAGACGTCGACTCAGTACGGCGTGGCCCAGGGCTCGACGCTCAACGTCGATCAGGAGAGGGCCATCGACAAGGTC
ATGAGGGCGCAGGACTACGCGCTGGTGCTGGGCATGCCGGGGACGGGCAAGACGACGACGATTGCCCACATCATC
CGGGCCTTGACGTCGCAGGGCAAGAGTGTGCTGCTGACGTCTCACACGCACACTGCCGTTGACAACATCCTTCTG
AAGCTCGAGGCCGACGACATCCCGGTGCTCCGACTGGGGGCCCCGGCCAAGATCCACGCCCAAGTACAGGGCTTC
GCCCGTCTGGCGGCCACGACGAGGAAGACGTTTGACGACATCAGGGACGCCTGGCACGGGACGCCCGTTGTGGCG
ACGACGTGTCTGGGTATCAACCACGCCCTGTTCCTGGAGCGGTCCTTTGACTACTGCATCGTCGACGAGGCGTCT
CAGATCACGCTGCCCATCTGCGCCGGGCCCATCCGCATGGCGAGCGCCTTTGTCCTAGTCGGAGACCATAACCAG
CTGCCCCCCGTGGTGCGAAACTCGGAGGCTCGCCAGGGGGGGCTGGACGTGAGCCTGTTCAAGCTGCTGTCCGAC
GCTCATCCGGAGTCGGTCGTCAACCTGGAGCATCAGTACCGCATGTGCGAGGACATCATGACGCTGAGCAACACT
CTCATCTACGACGGGAGGCTTCGCTGCGGTTACGAGGCCCTGCGCAGACGGAAGCTCGACGTCCCGGCCTTGGGC
GCCCTGAGGAACTTTCATCACGGCCCGGCCTCTCTCCTGAAGCGGCCGACGCCACGGTCCTTTTGTACTGGTCCG
ACGCCTTCGCGGTGCTGGCTGTACCATCTCATCGAGGGCGAGGCCCGCGTCCGCTTCGTCAACACGGACACCATC
CGTCCGGCCGTTCACGAGGAGGCCCAGGGAAAGCGCATCGTCAACCGTACAGAGGTCCGCATCGTCGGTCAGCTA
GTCGACGCCCTACTGGCAACAGGCGTGGCAGCCGAAGAAGTAGGCGTCATGACGCATTACCGCGCCCAGCTCGGC
CTCCTCCACCATCGTCTACGTCGCCACTCGGGCGTCGAGATGCACACGACGGACCGCTTCCAGGGCCGCGACAAG
GACGTCATGGTCGTCAGCCTGGTGAGATGCAACGAGGCCCGCAACATTGGCGACCTGCTGCGCGACTGGCGCCGT
ATAAACGTGGCCTTCACCCGCGCTCGTGCCAAGCTCCTCGTCATCGGCAGCAAGAGCACGCTCCAACAGGCCGAT
AACGGGATGCTCGGCCGCTTCGTCGCCCTGATGGAGAGTCGAGATTGGGTCTACGACTTGCCGGCCGATGCCGTC
GAAGCCCACGTCTTTGACGACGAGGCCTGGTCTGACCAGTCGTCGCCCTCTTCGCCTCCGCCCGTCGAGGTGGCC
GAGACGGGCAAGAAGCCGTCATCTTCGGCGTCGGCGGATAAGGAGAATCGCAGGAGGGGGTCGCCCAAGAAGGCG
AGGGTCGGGGCTAGGGCTCTCCTGAGGGGGAAGCCTGTTTTGAGGGATATACTTGCTGATATGATGAATGGGGCT
GAGATGCGCTGA
Transcript >Ophcf2|01453
ATGCCGCTACATAAATCCCACTCTGAGCGTCTTGGGCTGCGGAAAAGCCGGCAGCCATGGCAACGGTCCAGCAGT
CACCCTGTCGACCTGCAGACTCCGAAATCGAAGCCTCTTCTGCCTGTGTCGGAGGTAACCAAGGACAAGCTCAGC
AGGTTTCAGTACCACCCCGGCGAGGCCGACTCGACGCGCCAAGATGCCGGACAAACCTCGCCTTGGACGGCCAAC
GATGACACTTCCGCGGGGCAGACCCGACTGAACTGGCGGGACCTCATGGATCCTGGCGTTGCGGCCGAGGACGAC
ACCGACACGTCGCCCAGCGACAAAGTCCTGTGGAACAACAAACAAGACTCGCTCTACGTCTCAGCACTGTCTCCC
ATGCTGGCTCGGAAGAGGAAGCGTGCCAGGAGCTCTTCGCCCATTTCGTCTCCGCTGGCAGACAAGCCCGAGCCG
CCAACCGTCGACGTCGGCATGTTGCGAGAGGCTCTGAAGCTGGGACACGCCGATCCGACGATGGAGCTGTGGGAT
CGCTACTCTTACTCGCTCAACGGGCCCGAGAACGCGAAGTCGTCGCCGGGCGTCGTGAAGCCGGCTCTCGACCAG
TTGATGATATCATCCTCTCCGAAGCCGCGCGGTGATGATTCGGCGCTCAAGACCGACTTTGGCTTGCGGCGCGCC
ATGATGTGTGGTCTGAGTTGGCCAAAGAGGCGGAAAAACTCCAAGACTGAGCGGGTTCGGGTGAGCGACGAACAT
CAAGAGTTAGGGTCTTTGACCAAAAAACCGTCGCTCGTCACAGAACTGCTCGACACAGTGGATCAGGGACTTGAA
GAGGCCTGTGTCCAGCCCGAGCAGGACGAGTCCCCGTCGCTCAACAAGCGAAGACTGCCTCCAAATCCTCACAGC
TCTCCGTGTCGGGCGGTCGCCGGTGGCGGTGTCGTTGCGGATCTACCTTGTTCGGACTACGGCGATGACGACTTC
GACGACGATACGCTTACGGAACTCGAGGCGAGTCTCATTGCCGGAGACGGGACGAAAGCGCTGTCAAATACGAAT
CAGGGGATGAACGAGGCGTCGACGGCAAACGATGATGACATTGAGCTCGTTGATGATGGCAGCTCGAATCTAGAC
CAGCAGGTCACACGCGGTTCAGATGCCCCTAAAACGCCTCCTGGGCGACCTCAGAACAAGGGGGCTCAGAAGAGC
CCCGGAGACGAGTTCGAAGACGATTTCGACGCGGACATTGACTTTGATGCCGTTGAGCTGGCAGCGACTCAAACA
GTGCAGCAGCGGCGCGATGTGCCTCCAGCGACCAAAACGGAACCAAAAGCCAAGGTCATCCAGCGATACTTAGTA
ACGAGTGTGGTAGAGGGCGACTACATCGATGAGCTGGGCCACACCCGGCCCGAGAAGATGCTCATCATCCAAGCC
GACGGCTCCAAGGCAGCTCGGACGGTTCATCTGAGGGGCGCCTGGTTCGATACGCCCGCGCACACCGAGTCGTAC
GTTCACGTCATCGGCAAATTCTCCGCCAAGGGACAGTGCTTCGTCGACGACGCTCAGAATCTGTTGATCTTGCAC
CCTGATCAGCTCCTGTCTGCCACCGTCGTCGCCGACTCCTTTGGCTGCATGCGCCGCGCCGTCCTTCAGGATCGG
GTCAAGGCCACGAGCGAAGCCACGCCGCCTCTCGTCTACGGGACCATACTTCATGAGATTTTTCAAGAGGCCCTG
CTCGCCAACAGCTGGGATCTCGCTTTTCTCTCAGGCGTTATCAACAGGAAAGTGGAGGAGCACGTGGAGGATCTC
TATCGCATCAGGATCGGCATCGCGGCCGCCACTGAGCATCTGCTTTCGAAGATGACTGAGCTGAGTTACTGGGCA
AAAGCGTTTGTTTCCGCGGCGCCCAAGACCGATGCGGTGGTTGAGGATCGAAACGGCAAGACGGCTGCCATGGCC
GTCAGGAAGCTACTCGATGTCGAGGAGCACGTCTGGTCTCCAATGTATGGACTGAAAGGGAATATCGACGCCACT
GTCGAGGTCGTCATGGCGGACGGAAAGGAGAAACGGACCCTCACGGTTCCGTTCGAGTTGAAGACGGGGAGACAA
GCGAACAGCAGCCATATGGCGCAGACGGCGCTCTACACCCTGCTTCTGGCGGATCGGTACGACATCGACATCGCC
TACGGCATCCTCTACTACATGGAGACTTCCAAGACGATGCGGATTCCGGCCGTACGGCATGAGCTGAGGCACATG
ATTATGCAGCGGAACCAGTTGGCCTGCCATATCCGAGAGCGAAGCGTCAAACTTCCTCCCATGCTCAAGAACAAG
CACGTGTGCGGAAGATGCTATGCCAAGACGTCTTGCTTCATATATCATCGACTGGCAGACGAGGGCGACGCCGAG
TCGAGTGGCATGAAGGACAAGTTTGACGAGCTCGTCCGGCACCTGACGCCTGCCCATCGGGACTTTTTCGTCCGG
TGGGAGAATCTCCTGACCAAGGAGGAAAAGGAGAGCCAGAAGACCAAGAGGGAGCTGTGGACGATGACGAGCTCA
GAGCGGGAGAAGAAGTCTCGATGCTTTGCCGACGTCATCATCGAACAAGGGTCCGGCTCGGAGACGGCATCCAGC
GGACGGATCAACCGGTTTCACTACACTTTCGTCAAGCGGCTTCCCCAGCCCAAGTTTTCGTTCCTCGAGTCGGAG
CTGTCGACGGGCGAGCCTGTCGTGGTATCGGACGAGGAGGGCCACTTTGCCTTGGCCATTGGCTACGTGACGTCG
GTCCGCAAGCAGAGGATCAGCGTCGCCGTCGACAGGCGTCTTCACAACGCCAGAATCAGGCAGCCCGGGTTTGAC
GACAAGTACAACCAGGTGTTTGCCAGCATCATGGAGGTGCAGCCGGAAGCGAGGGAGGAGGTTCCGGTCCAAAGT
CAGCCATTGCGGTACCGACTGGACAAGGACGAGTTCAGCAACGGCATGGCGACGGTCAGGAACAATCTGGTGCAG
ATGATGGCCAACGACGTGCCGGCGGCTGTCAAGATGAGGAGGCTGCTCGTCGACCTGGAGGCGCCTCGGTTCAAG
GAGACGTCGACTCAGTACGGCGTGGCCCAGGGCTCGACGCTCAACGTCGATCAGGAGAGGGCCATCGACAAGGTC
ATGAGGGCGCAGGACTACGCGCTGGTGCTGGGCATGCCGGGGACGGGCAAGACGACGACGATTGCCCACATCATC
CGGGCCTTGACGTCGCAGGGCAAGAGTGTGCTGCTGACGTCTCACACGCACACTGCCGTTGACAACATCCTTCTG
AAGCTCGAGGCCGACGACATCCCGGTGCTCCGACTGGGGGCCCCGGCCAAGATCCACGCCCAAGTACAGGGCTTC
GCCCGTCTGGCGGCCACGACGAGGAAGACGTTTGACGACATCAGGGACGCCTGGCACGGGACGCCCGTTGTGGCG
ACGACGTGTCTGGGTATCAACCACGCCCTGTTCCTGGAGCGGTCCTTTGACTACTGCATCGTCGACGAGGCGTCT
CAGATCACGCTGCCCATCTGCGCCGGGCCCATCCGCATGGCGAGCGCCTTTGTCCTAGTCGGAGACCATAACCAG
CTGCCCCCCGTGGTGCGAAACTCGGAGGCTCGCCAGGGGGGGCTGGACGTGAGCCTGTTCAAGCTGCTGTCCGAC
GCTCATCCGGAGTCGGTCGTCAACCTGGAGCATCAGTACCGCATGTGCGAGGACATCATGACGCTGAGCAACACT
CTCATCTACGACGGGAGGCTTCGCTGCGGTTACGAGGCCCTGCGCAGACGGAAGCTCGACGTCCCGGCCTTGGGC
GCCCTGAGGAACTTTCATCACGGCCCGGCCTCTCTCCTGAAGCGGCCGACGCCACGGTCCTTTTGTACTGGTCCG
ACGCCTTCGCGGTGCTGGCTGTACCATCTCATCGAGGGCGAGGCCCGCGTCCGCTTCGTCAACACGGACACCATC
CGTCCGGCCGTTCACGAGGAGGCCCAGGGAAAGCGCATCGTCAACCGTACAGAGGTCCGCATCGTCGGTCAGCTA
GTCGACGCCCTACTGGCAACAGGCGTGGCAGCCGAAGAAGTAGGCGTCATGACGCATTACCGCGCCCAGCTCGGC
CTCCTCCACCATCGTCTACGTCGCCACTCGGGCGTCGAGATGCACACGACGGACCGCTTCCAGGGCCGCGACAAG
GACGTCATGGTCGTCAGCCTGGTGAGATGCAACGAGGCCCGCAACATTGGCGACCTGCTGCGCGACTGGCGCCGT
ATAAACGTGGCCTTCACCCGCGCTCGTGCCAAGCTCCTCGTCATCGGCAGCAAGAGCACGCTCCAACAGGCCGAT
AACGGGATGCTCGGCCGCTTCGTCGCCCTGATGGAGAGTCGAGATTGGGTCTACGACTTGCCGGCCGATGCCGTC
GAAGCCCACGTCTTTGACGACGAGGCCTGGTCTGACCAGTCGTCGCCCTCTTCGCCTCCGCCCGTCGAGGTGGCC
GAGACGGGCAAGAAGCCGTCATCTTCGGCGTCGGCGGATAAGGAGAATCGCAGGAGGGGGTCGCCCAAGAAGGCG
AGGGTCGGGGCTAGGGCTCTCCTGAGGGGGAAGCCTGTTTTGAGGGATATACTTGCTGATATGATGAATGGGGCT
GAGATGCGCTGA
Gene >Ophcf2|01453
ATGCCGCTACATAAATCCCACTCTGAGCGTCTTGGGCTGCGGAAAGTGAGTGAGAGTAGGCTCAGCGGCGGCATG
ACGTTGCTAAGCCTCTGCGGATAGAGCCGGCAGCCATGGCAACGGTCCAGCAGTCACCCTGTCGACCTGCAGACT
CCGAAATCGAAGCCTCTTCTGCCTGTGTCGGAGGTAACCAAGGACAAGCTCAGCAGGTTTCAGTACCACCCCGGC
GAGGCCGACTCGACGCGCCAAGATGCCGGACAAACCTCGCCTTGGACGGCCAACGATGACACTTCCGCGGGGCAG
ACCCGACTGAACTGGCGGGACCTCATGGATCCTGGCGTTGCGGCCGAGGACGACACCGACACGTCGCCCAGCGAC
AAAGTCCTGTGGAACAACAAACAAGACTCGCTCTACGTCTCAGCACTGTCTCCCATGCTGGCTCGGAAGAGGAAG
CGTGCCAGGAGCTCTTCGCCCATTTCGTCTCCGCTGGCAGACAAGCCCGAGCCGCCAACCGTCGACGTCGGCATG
TTGCGAGAGGCTCTGAAGCTGGGACACGCCGATCCGACGATGGAGCTGTGGGATCGCTACTCTTACTCGCTCAAC
GGGCCCGAGAACGCGAAGTCGTCGCCGGGCGTCGTGAAGCCGGCTCTCGACCAGTTGATGATATCATCCTCTCCG
AAGCCGCGCGGTGATGATTCGGCGCTCAAGACCGACTTTGGCTTGCGGCGCGCCATGATGTGTGGTCTGAGTTGG
CCAAAGAGGCGGAAAAACTCCAAGACTGAGCGGGTTCGGGTGAGCGACGAACATCAAGAGTTAGGGTCTTTGACC
AAAAAACCGTCGCTCGTCACAGAACTGCTCGACACAGTGGATCAGGGACTTGAAGAGGCCTGTGTCCAGCCCGAG
CAGGACGAGTCCCCGTCGCTCAACAAGCGAAGACTGCCTCCAAATCCTCACAGCTCTCCGTGTCGGGCGGTCGCC
GGTGGCGGTGTCGTTGCGGATCTACCTTGTTCGGACTACGGCGATGACGACTTCGACGACGATACGCTTACGGAA
CTCGAGGCGAGTCTCATTGCCGGAGACGGGACGAAAGCGCTGTCAAATACGAATCAGGGGATGAACGAGGCGTCG
ACGGCAAACGATGATGACATTGAGCTCGTTGATGATGGCAGCTCGAATCTAGACCAGCAGGTCACACGCGGTTCA
GATGCCCCTAAAACGCCTCCTGGGCGACCTCAGAACAAGGGGGCTCAGAAGAGCCCCGGAGACGAGTTCGAAGAC
GATTTCGACGCGGACATTGACTTTGATGCCGTTGAGCTGGCAGCGACTCAAACAGTGCAGCAGCGGCGCGATGTG
CCTCCAGCGACCAAAGTACGTCAGATTTAGCATGAGCGAGGCCTTCCCATGGATCATTTACTAAGTCAAGGTAGA
CGGAACCAAAAGCCAAGGTCATCCAGCGATACTTAGTAACGAGTGTGGTAGAGGGCGACTACATCGATGAGCTGG
GCCACACCCGGCCCGAGAAGGTGAGGCGGACAAGTCTCCAGAGGCTCTCGGAGGTTGCTAATGAAGATAAGATGC
TCATCATCCAAGCCGACGGCTCCAAGGCAGCTCGGACGGTTCATCTGAGGGGCGCCTGGTTCGATACGCCCGCGC
ACACCGAGTCGTACGTTCACGTCATCGGCAAATTCTCCGCCAAGGGACAGTGCTTCGTCGACGACGCTCAGAATC
TGTTGATCTTGCACCCTGATCAGCTCCTGTCTGCCACCGTCGTCGCCGACTCCTTTGGCTGCATGCGCCGCGCCG
TCCTTCAGGATCGGGTCAAGGCCACGAGCGAAGCCACGCCGCCTCTCGTCTACGGGACCATACTTCATGAGATTT
TTCAAGAGGCCCTGCTCGCCAACAGCTGGGATCTCGCTTTTCTCTCAGGCGTTATCAACAGGAAAGTGGAGGAGC
ACGTGGAGGATCTCTATCGCATCAGGATCGGCATCGCGGCCGCCACTGAGCATCTGCTTTCGAAGATGACTGAGC
TGAGTTACTGGGCAAAAGCGTTTGTTTCCGCGGCGCCCAAGGTGAGCTAAACAATTGTACGAGTCGAGCTTGGCT
GACGGTGGTGCAGACCGATGCGGTGGTTGAGGATCGAAACGGCAAGACGGCTGCCATGGCCGTCAGGAAGCTACT
CGATGTCGAGGAGCACGTCTGGTCTCCAATGTATGGACTGAAAGGGAATATCGACGCCACTGTCGAGGTCGTCAT
GGCGGACGGAAAGGAGAAACGGACCCTCACGGTTCCGTTCGAGTTGAAGACGGGGAGACAAGCGAACAGCAGCCA
TATGGCGCAGACGGCGCTCTACACCCTGCTTCTGGCGGATCGGTACGACATCGACATCGCCTACGGCATCCTCTA
CTACATGGAGACTTCCAAGACGATGCGGATTCCGGCCGTACGGCATGAGCTGAGGCACATGATTATGCAGCGGAA
CCAGTTGGCCTGCCATATCCGAGAGCGAAGCGTCAAACTTCCTCCCATGCTCAAGAACAAGCACGTGTGCGGAAG
ATGCTATGCCAAGACGTCTTGCTTCATATATCATCGACTGGCAGACGAGGGCGACGCCGAGTCGAGTGGCATGAA
GGACAAGTTTGACGAGCTCGTCCGGCACCTGACGCCTGCCCATCGGGACTTTTTCGTCCGGTGGGAGAATCTCCT
GACCAAGGAGGAAAAGGAGAGCCAGAAGACCAAGAGGGAGCTGTGGACGATGACGAGCTCAGAGCGGGAGAAGAA
GTCTCGATGCTTTGCCGACGTCATCATCGAACAAGGGTCCGGCTCGGAGACGGCATCCAGCGGACGGATCAACCG
GTTTCACTACACTTTCGTCAAGCGGCTTCCCCAGCCCAAGTTTTCGTTCCTCGAGTCGGAGCTGTCGACGGGCGA
GCCTGTCGTGGTATCGGACGAGGAGGGCCACTTTGCCTTGGCCATTGGCTACGTGACGTCGGTCCGCAAGCAGAG
GATCAGCGTCGCCGTCGACAGGCGTCTTCACAACGCCAGAATCAGGCAGCCCGGGTTTGACGACAAGTACAACCA
GGTGTTTGCCAGCATCATGGAGGTGCAGCCGGAAGCGAGGGAGGAGGTTCCGGTCCAAAGTCAGCCATTGCGGTA
CCGACTGGACAAGGACGAGTTCAGCAACGGCATGGCGACGGTCAGGAACAATCTGGTGCAGATGATGGCCAACGA
CGTGCCGGCGGCTGTCAAGATGAGGAGGCTGCTCGTCGACCTGGAGGCGCCTCGGTTCAAGGAGACGTCGACTCA
GTACGGCGTGGCCCAGGGCTCGACGCTCAACGTCGATCAGGAGAGGGCCATCGACAAGGTCATGAGGGCGCAGGA
CTACGCGCTGGTGCTGGGCATGCCGGGGACGGGCAAGACGACGACGATTGCCCACATCATCCGGGCCTTGACGTC
GCAGGGCAAGAGTGTGCTGCTGACGTCTCACACGCACACTGCCGTTGACAACATCCTTCTGAAGCTCGAGGCCGA
CGACATCCCGGTGCTCCGACTGGGGGCCCCGGCCAAGATCCACGCCCAAGTACAGGGCTTCGCCCGTCTGGCGGC
CACGACGAGGAAGACGTTTGACGACATCAGGGACGCCTGGCACGGGACGCCCGTTGTGGCGACGACGTGTCTGGG
TATCAACCACGCCCTGTTCCTGGAGCGGTCCTTTGACTACTGCATCGTCGACGAGGCGTCTCAGATCACGCTGCC
CATCTGCGCCGGGCCCATCCGCATGGCGAGCGCCTTTGTCCTAGTCGGAGACCATAACCAGCTGCCCCCCGTGGT
GCGAAACTCGGAGGCTCGCCAGGGGGGGCTGGACGTGAGCCTGTTCAAGCTGCTGTCCGACGCTCATCCGGAGTC
GGTCGTCAACCTGGAGCATCAGTACCGCATGTGCGAGGACATCATGACGCTGAGCAACACTCTCATCTACGACGG
GAGGCTTCGCTGCGGTTACGAGGCCCTGCGCAGACGGAAGCTCGACGTCCCGGCCTTGGGCGCCCTGAGGAACTT
TCATCACGGCCCGGCCTCTCTCCTGAAGCGGCCGACGCCACGGTCCTTTTGTACTGGTCCGACGCCTTCGCGGTG
CTGGCTGTACCATCTCATCGAGGGCGAGGCCCGCGTCCGCTTCGTCAACACGGACACCATCCGTCCGGCCGTTCA
CGAGGAGGCCCAGGGAAAGCGCATCGTCAACCGTACAGAGGTCCGCATCGTCGGTCAGCTAGTCGACGCCCTACT
GGCAACAGGCGTGGCAGCCGAAGAAGTAGGCGTCATGACGCATTACCGCGCCCAGCTCGGCCTCCTCCACCATCG
TCTACGTCGCCACTCGGGCGTCGAGATGCACACGACGGACCGCTTCCAGGGCCGCGACAAGGACGTCATGGTCGT
CAGCCTGGTGAGATGCAACGAGGCCCGCAACATTGGCGACCTGCTGCGCGACTGGCGCCGTATAAACGTGGCCTT
CACCCGCGCTCGTGCCAAGCTCCTCGTCATCGGCAGCAAGAGCACGCTCCAACAGGCCGATAACGGGATGCTCGG
CCGCTTCGTCGCCCTGATGGAGAGTCGAGATTGGGTCTACGACTTGCCGGCCGATGCCGTCGAAGCCCACGTCTT
TGACGACGAGGCCTGGTCTGACCAGTCGTCGCCCTCTTCGCCTCCGCCCGTCGAGGTGGCCGAGACGGGCAAGAA
GCCGTCATCTTCGGCGTCGGCGGATAAGGAGAATCGCAGGAGGGGGTCGCCCAAGAAGGCGAGGGTCGGGGCTAG
GGCTCTCCTGAGGGGGAAGCCTGTTTTGAGGGATATACTTGCTGATATGATGAATGGGGCTGAGATGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail