Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01452
Gene name
Locationscaffold_01:5038581..5039643
Strand-
Gene length (bp)1062
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 85 104 19
2 147 169 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 105.78 60.75 150.82
Alive In ants, during behavior modification 87.59 49.37 125.80
Dead In ants, recently dead 97.72 55.86 139.59

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.349196 no
Alive Dead 0.547496 no
Dead Fungus 0.720850 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01452
MAEKPQRRRYENATDLILARKQFQPVIHEQVQRLLNRDSDGVPLRKSSKVAIVTEKFAVDVATTWGSQLSDEQIM
AVARRSSQALNWILFFKISVGCFAGYRTFKGRKTFRFPLWTPKPDTWSPRLNPYTCGDGGRYVWHGLRWASYYAL
YSALFAPISSLFITTSFAIELEKDPQFRSMVMNDQQNDAQPPTDQNGWGSRSQSERITDQASVYAENSISARARP
GWAASRRQQNEAPQQDSLDNVLDDASPVSSTTPQDDGLDTNFSGSAWDRVRQQSRDQQGHDARNAETAYGHDRRA
AGPQDRGGNESYTFSSSDEDGAAAKTVSQKEFDDLLERERRGIDQQSTSGRRS*
Coding >Ophcf2|01452
ATGGCGGAAAAGCCCCAACGCCGACGATATGAAAACGCCACGGATCTCATTCTCGCCCGCAAACAGTTCCAGCCA
GTAATCCACGAGCAGGTCCAGCGCCTACTCAACAGGGACAGCGACGGCGTCCCACTCCGCAAATCCTCCAAAGTC
GCTATAGTGACGGAGAAGTTCGCCGTCGACGTTGCCACCACGTGGGGAAGTCAACTTAGCGATGAACAGATCATG
GCAGTGGCCCGGAGAAGCTCCCAGGCCCTCAACTGGATATTGTTCTTCAAGATCAGTGTAGGATGCTTCGCAGGC
TATCGGACTTTCAAGGGCCGCAAGACTTTTCGATTTCCCTTGTGGACTCCTAAGCCAGACACCTGGAGTCCTAGA
CTCAATCCATACACGTGCGGAGACGGTGGTCGATATGTTTGGCATGGGCTTCGCTGGGCCTCGTACTATGCCTTG
TACAGCGCCCTTTTTGCCCCGATATCGTCTCTGTTCATCACGACCTCATTTGCAATCGAATTGGAAAAGGACCCG
CAGTTCCGGAGCATGGTAATGAATGACCAGCAGAACGATGCTCAGCCCCCGACCGATCAGAATGGATGGGGATCT
AGGTCACAATCGGAGCGTATCACGGATCAAGCATCCGTCTACGCGGAGAACAGTATATCAGCTCGAGCTCGACCC
GGATGGGCCGCGTCTCGACGACAGCAAAACGAAGCCCCGCAACAGGACTCGTTGGATAATGTCCTCGACGACGCC
TCTCCAGTCTCTTCTACCACACCACAAGATGACGGCCTCGACACCAACTTCAGCGGCTCAGCCTGGGATCGCGTC
CGCCAACAATCGCGAGATCAGCAGGGTCACGACGCCCGCAACGCTGAGACGGCTTATGGGCACGATCGCCGCGCG
GCAGGTCCTCAGGACCGGGGAGGCAACGAGAGCTATACCTTCTCGAGCTCTGACGAGGATGGGGCCGCGGCCAAG
ACGGTCTCGCAAAAGGAGTTTGACGACCTCTTGGAGAGAGAGCGTCGTGGCATTGACCAGCAGTCGACTTCCGGG
CGCCGGAGTTGA
Transcript >Ophcf2|01452
ATGGCGGAAAAGCCCCAACGCCGACGATATGAAAACGCCACGGATCTCATTCTCGCCCGCAAACAGTTCCAGCCA
GTAATCCACGAGCAGGTCCAGCGCCTACTCAACAGGGACAGCGACGGCGTCCCACTCCGCAAATCCTCCAAAGTC
GCTATAGTGACGGAGAAGTTCGCCGTCGACGTTGCCACCACGTGGGGAAGTCAACTTAGCGATGAACAGATCATG
GCAGTGGCCCGGAGAAGCTCCCAGGCCCTCAACTGGATATTGTTCTTCAAGATCAGTGTAGGATGCTTCGCAGGC
TATCGGACTTTCAAGGGCCGCAAGACTTTTCGATTTCCCTTGTGGACTCCTAAGCCAGACACCTGGAGTCCTAGA
CTCAATCCATACACGTGCGGAGACGGTGGTCGATATGTTTGGCATGGGCTTCGCTGGGCCTCGTACTATGCCTTG
TACAGCGCCCTTTTTGCCCCGATATCGTCTCTGTTCATCACGACCTCATTTGCAATCGAATTGGAAAAGGACCCG
CAGTTCCGGAGCATGGTAATGAATGACCAGCAGAACGATGCTCAGCCCCCGACCGATCAGAATGGATGGGGATCT
AGGTCACAATCGGAGCGTATCACGGATCAAGCATCCGTCTACGCGGAGAACAGTATATCAGCTCGAGCTCGACCC
GGATGGGCCGCGTCTCGACGACAGCAAAACGAAGCCCCGCAACAGGACTCGTTGGATAATGTCCTCGACGACGCC
TCTCCAGTCTCTTCTACCACACCACAAGATGACGGCCTCGACACCAACTTCAGCGGCTCAGCCTGGGATCGCGTC
CGCCAACAATCGCGAGATCAGCAGGGTCACGACGCCCGCAACGCTGAGACGGCTTATGGGCACGATCGCCGCGCG
GCAGGTCCTCAGGACCGGGGAGGCAACGAGAGCTATACCTTCTCGAGCTCTGACGAGGATGGGGCCGCGGCCAAG
ACGGTCTCGCAAAAGGAGTTTGACGACCTCTTGGAGAGAGAGCGTCGTGGCATTGACCAGCAGTCGACTTCCGGG
CGCCGGAGTTGA
Gene >Ophcf2|01452
ATGGCGGAAAAGCCCCAACGCCGACGATATGAAAACGCCACGGATCTCATTCTCGCCCGCAAACAGTTCCAGCCA
GTAATCCACGAGCAGGTCCAGCGCCTACTCAACAGGGACAGCGACGGCGTCCCACTCCGCAAATCCTCCAAAGTC
GCTATAGTGACGGAGAAGTTCGCCGTCGACGTTGCCACCACGTGGGGAAGTCAACTTAGCGATGAACAGATCATG
GCAGTGGCCCGGAGAAGCTCCCAGGCCCTCAACTGGATATTGTTCTTCAAGATCAGTGTAGGATGCTTCGCAGGC
TATCGGACTTTCAAGGGCCGCAAGACTTTTCGATTTCCCTTGTGGACTCCTAAGCCAGACACCTGGAGTCCTAGA
CTCAATCCATACACGTGCGGAGACGGTGGTCGATATGTTTGGCATGGGCTTCGCTGGGCCTCGTACTATGCCTTG
TACAGCGCCCTTTTTGCCCCGATATCGTCTCTGTTCATCACGACCTCATTTGCAATCGAATTGGAAAAGGACCCG
CAGTTCCGGAGCATGGTAATGAATGACCAGCAGAACGATGCTCAGCCCCCGACCGATCAGAATGGATGGGGATCT
AGGTCACAATCGGAGCGTATCACGGATCAAGCATCCGTCTACGCGGAGAACAGTATATCAGCTCGAGCTCGACCC
GGATGGGCCGCGTCTCGACGACAGCAAAACGAAGCCCCGCAACAGGACTCGTTGGATAATGTCCTCGACGACGCC
TCTCCAGTCTCTTCTACCACACCACAAGATGACGGCCTCGACACCAACTTCAGCGGCTCAGCCTGGGATCGCGTC
CGCCAACAATCGCGAGATCAGCAGGGTCACGACGCCCGCAACGCTGAGACGGCTTATGGGCACGATCGCCGCGCG
GCAGGTCCTCAGGACCGGGGAGGCAACGAGAGCTATACCTTCTCGAGCTCTGACGAGGATGGGGCCGCGGCCAAG
ACGGTCTCGCAAAAGGAGTTTGACGACCTCTTGGAGAGAGAGCGTCGTGGCATTGACCAGCAGTCGACTTCCGGG
CGCCGGAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail