Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01444
Gene name
Locationscaffold_01:5021678..5023061
Strand-
Gene length (bp)1383
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04366 Ysc84 Las17-binding protein actin regulator 1.5E-38 90 213
PF07653 SH3_2 Variant SH3 domain 3.1E-13 349 400
PF00018 SH3_1 SH3 domain 1.8E-10 349 396
PF14604 SH3_9 Variant SH3 domain 2.8E-09 350 400

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4898 0.2054 0.1562 0.1553 0.3234 0.0427 0.1786 0.3344 0.1988 0.0091

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2570
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3532
Ophiocordyceps australis map64 (Brazil) OphauB2|7278
Ophiocordyceps camponoti-floridani Ophcf2|01444 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5701
Ophiocordyceps kimflemingae Ophio5|1405
Ophiocordyceps subramaniannii Hirsu2|3831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01444
MGGLNNPFPSSLRSECKKCGRILKSFVNPRQSLGPDRVIHPSVLSNAKGLAVFTVLRAGCLGSGRIGSGLVVARL
PDGRWSAPSAAALVGGGFGGLIGAELTDFVFVLNDVNAVKTLAQAGSLALGGNVSLAAGPIGRSAEADAAASLKS
FSGIYTYCKTKGLFAGISLEGSVIIERRDANESLYRTRYTAQQILTGSVEAPSEAQPLTDILNTRYFSGDHADAM
HGNTMYNDEPVYATEHDDVVWEGRRGSGYGENTSRRRDTAAGAGAGEAAEPTTTAAAAATSTTTANSKHNSHQEY
VYRDVPSTPTDPTPNKDTPPKRVTKHDTAKSSPAPTKADMANLGKDEAIAIFTFDPAQPGDLGFKRGDVIKVTKR
TDSDNDWWTGMIGMRRGTFPSNYVKMND*
Coding >Ophcf2|01444
ATGGGCGGCCTCAACAACCCATTCCCTTCCTCCCTCCGAAGCGAATGCAAAAAATGCGGCCGCATCCTTAAATCC
TTCGTCAACCCCCGTCAATCCCTCGGCCCCGACCGCGTAATCCACCCTTCCGTCCTCTCCAACGCAAAAGGCCTC
GCCGTCTTCACCGTCCTACGAGCAGGCTGTCTAGGAAGCGGCCGTATCGGATCCGGTCTGGTCGTCGCCCGTCTC
CCCGATGGACGCTGGAGTGCGCCCAGTGCGGCTGCCCTGGTGGGCGGTGGCTTCGGCGGCTTGATCGGGGCGGAA
CTTACGGATTTCGTCTTCGTGCTTAATGATGTTAATGCTGTCAAGACGCTTGCTCAGGCTGGTTCCCTGGCTCTC
GGGGGGAATGTCTCGTTGGCGGCTGGACCGATTGGAAGGTCTGCTGAGGCTGATGCTGCCGCTTCTCTCAAGAGC
TTCTCGGGCATTTACACTTATTGCAAGACGAAGGGACTCTTCGCGGGGATATCACTAGAAGGATCCGTCATCATC
GAACGACGCGATGCGAACGAATCCCTCTACCGAACGAGATACACAGCTCAGCAGATTCTCACCGGATCAGTCGAA
GCACCATCAGAAGCCCAGCCTCTAACCGACATCCTCAACACGCGATACTTCAGCGGCGACCACGCAGACGCAATG
CACGGAAACACAATGTACAACGATGAGCCCGTCTACGCTACCGAACACGATGACGTCGTCTGGGAAGGTCGTCGC
GGCTCCGGCTACGGAGAGAACACATCCCGCAGACGCGATACCGCAGCCGGAGCCGGAGCCGGAGAAGCAGCAGAA
CCAACAACAACAGCAGCAGCAGCAGCAACATCAACAACAACAGCAAACAGCAAACACAACTCCCACCAAGAATAC
GTCTACCGCGACGTCCCCTCGACCCCCACCGACCCAACCCCCAACAAAGACACGCCCCCCAAACGCGTAACCAAG
CACGACACAGCAAAGTCATCCCCCGCCCCCACGAAAGCAGACATGGCCAATCTCGGCAAAGACGAAGCCATCGCC
ATCTTCACCTTTGACCCTGCGCAGCCTGGCGATCTCGGCTTCAAGAGGGGTGACGTCATAAAGGTCACCAAGCGG
ACGGATAGCGACAATGACTGGTGGACTGGAATGATTGGGATGCGTCGGGGTACTTTTCCCAGCAACTACGTCAAG
ATGAACGACTAG
Transcript >Ophcf2|01444
ATGGGCGGCCTCAACAACCCATTCCCTTCCTCCCTCCGAAGCGAATGCAAAAAATGCGGCCGCATCCTTAAATCC
TTCGTCAACCCCCGTCAATCCCTCGGCCCCGACCGCGTAATCCACCCTTCCGTCCTCTCCAACGCAAAAGGCCTC
GCCGTCTTCACCGTCCTACGAGCAGGCTGTCTAGGAAGCGGCCGTATCGGATCCGGTCTGGTCGTCGCCCGTCTC
CCCGATGGACGCTGGAGTGCGCCCAGTGCGGCTGCCCTGGTGGGCGGTGGCTTCGGCGGCTTGATCGGGGCGGAA
CTTACGGATTTCGTCTTCGTGCTTAATGATGTTAATGCTGTCAAGACGCTTGCTCAGGCTGGTTCCCTGGCTCTC
GGGGGGAATGTCTCGTTGGCGGCTGGACCGATTGGAAGGTCTGCTGAGGCTGATGCTGCCGCTTCTCTCAAGAGC
TTCTCGGGCATTTACACTTATTGCAAGACGAAGGGACTCTTCGCGGGGATATCACTAGAAGGATCCGTCATCATC
GAACGACGCGATGCGAACGAATCCCTCTACCGAACGAGATACACAGCTCAGCAGATTCTCACCGGATCAGTCGAA
GCACCATCAGAAGCCCAGCCTCTAACCGACATCCTCAACACGCGATACTTCAGCGGCGACCACGCAGACGCAATG
CACGGAAACACAATGTACAACGATGAGCCCGTCTACGCTACCGAACACGATGACGTCGTCTGGGAAGGTCGTCGC
GGCTCCGGCTACGGAGAGAACACATCCCGCAGACGCGATACCGCAGCCGGAGCCGGAGCCGGAGAAGCAGCAGAA
CCAACAACAACAGCAGCAGCAGCAGCAACATCAACAACAACAGCAAACAGCAAACACAACTCCCACCAAGAATAC
GTCTACCGCGACGTCCCCTCGACCCCCACCGACCCAACCCCCAACAAAGACACGCCCCCCAAACGCGTAACCAAG
CACGACACAGCAAAGTCATCCCCCGCCCCCACGAAAGCAGACATGGCCAATCTCGGCAAAGACGAAGCCATCGCC
ATCTTCACCTTTGACCCTGCGCAGCCTGGCGATCTCGGCTTCAAGAGGGGTGACGTCATAAAGGTCACCAAGCGG
ACGGATAGCGACAATGACTGGTGGACTGGAATGATTGGGATGCGTCGGGGTACTTTTCCCAGCAACTACGTCAAG
ATGAACGACTAG
Gene >Ophcf2|01444
ATGGGCGGCCTCAACAACCCATTCCCTTCCTCCCTCCGAAGTCCGTCATTCTCCTCTGCTTTCCTCTCCTCCCCT
CTCTCCATCTAACTAACATGTTCAAAAAAAAAAAAAAACAGGCGAATGCAAAAAATGCGGCCGCATCCTTAAATC
CTTCGTCAACCCCCGTCAATCCCTCGGCCCCGACCGCGTAATCCACCCTTCCGTCCTCTCCAACGCAAAAGGCCT
CGCCGTCTTCACCGTCCTACGAGCAGGCTGTCTAGGAAGCGGCCGTATCGGATCCGGTCTGGTCGTCGCCCGTCT
CCCCGATGGACGCTGGAGTGCGCCCAGTGCGGCTGCCCTGGTGGGCGGTGGCTTCGGCGGCTTGATCGGGGCGGA
ACTTACGGATTTCGTCTTCGTGCTTAATGATGTTAATGCTGTCAAGACGCTTGCTCAGGCTGGTTCCCTGGCTCT
CGGGGGGAATGTCTCGTTGGCGGCTGGACCGATTGGAAGGTCTGCTGAGGCTGATGCTGCCGCTTCTCTCAAGAG
CTTCTCGGGCATTTACACTTATTGCAAGACGAAGGGACTCTTCGCGGGGATATCACTAGAAGGATCCGTCATCAT
CGAACGACGCGATGCGAACGAATCCCTCTACCGAACGAGATACACAGCTCAGCAGATTCTCACCGGATCAGTCGA
AGCACCATCAGAAGCCCAGCCTCTAACCGACATCCTCAACACGCGATACTTCAGCGGCGACCACGCAGACGCAAT
GCACGGAAACACAATGTACAACGATGAGCCCGTCTACGCTACCGAACACGATGACGTCGTCTGGGAAGGTCGTCG
CGGCTCCGGCTACGGAGAGAACACATCCCGCAGACGCGATACCGCAGCCGGAGCCGGAGCCGGAGAAGCAGCAGA
ACCAACAACAACAGCAGCAGCAGCAGCAACATCAACAACAACAGCAAACAGCAAACACAACTCCCACCAAGAATA
CGTCTACCGCGACGTCCCCTCGACCCCCACCGACCCAACCCCCAACAAAGACACGCCCCCCAAACGCGTAACCAA
GCACGACACAGCAAAGTCATCCCCCGCCCCCACGAAAGCAGACATGGCCAATCTCGGCAAAGACGAAGCCATCGC
CATCTTCACCTTTGACCCTGCGCAGCCTGGCGATCTCGGCTTCAAGAGGGGTGACGTCATAAAGGTCACCAAGCG
GACGGATAGCGACAATGACTGGTGGTATGTTTTTTTTTTTTTTCGGTTTCTTTTTGTGTTTCTCCCCCCCCCCCC
GTCTTGTTCGTTTCTATGACGCTTTGCTCTGACGCCTTGACTAGGACTGGAATGATTGGGATGCGTCGGGGTACT
TTTCCCAGCAACTACGTCAAGATGAACGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail