Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01441
Gene name
Locationscaffold_01:5011278..5014269
Strand-
Gene length (bp)2991
Transcript length (bp)2838
Coding sequence length (bp)2838
Protein length (aa) 946

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01388 ARID ARID/BRIGHT DNA binding domain 2.4E-16 19 106

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4051 0.8123 0.0872 0.0572 0.0328 0.0065 0.0411 0.0156 0.0192 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
ARID/BRIGHT

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1589
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|367
Ophiocordyceps australis map64 (Brazil) OphauB2|7271
Ophiocordyceps camponoti-floridani Ophcf2|01441 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5704
Ophiocordyceps kimflemingae Ophio5|6831
Ophiocordyceps subramaniannii Hirsu2|1211

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01441
MTVSPQEAQMHAIDRTPEYEEFMTKLRDYHARRGTTLDPEPRVGVIHLDLFKVFNHIVANGGYDKVSEEKLAWRR
MASELGIFSNNEASTAFSLKEKFYKNLAAFEISTIHGKEPPPKDILEDVTAKGASLLTRTRDNFRGKRDVNATDS
AASGDDGTPTRERPAVENPTSSSRASRGLREAPPQRVIFQPDTSSSRPTRQATNHQSAPTPAPTQPPISANTPLS
LQPMPPQTGHHQAGHHPARHGPSIVHQPPNAEDTSQLVLSYQPRNMRPLQLRPVATPGYAPAEFPRPRPPQRPPP
LHISGRQPMLPGTGFDGPNIYTRCLMALRSGLPAEQAFALNHLVKISYERGDKYRFDAFPGLAEGLVGKALHVGR
LFYHVDWTLSWDLYPDSTDVGTLDGNNGTPDILERIQGLVERDVPEALQTEKFADEMVLVTEAVLTMRNMVTLPD
NAVNMSDFPPLKDLICILLHLPAHDSLVEMKHLALDIAEQLAPYMALEADNPLYKTLLSQLGSEDRGMILTALRA
LGRISMNLEATNTLAHVKPEALRRIVNWLLLNDDELIDACLDFLYQYTAVVANLDHLVRSTRPEDVVDHLVRLLA
HGARKVQRELMLMPERRLPSRDEIAPMPEDLLQEMVKLEEPERVHRWVKCFFDEDNGSFVTQLAAWQAYQSAFAG
PLKDAGKAMITPADFIRSSTSVYKNSNAQVLREPGEGQQKFIIHGIRARARPLSFEGAEYGRCLWATNAERKNEK
CGQFYLKPEQMAEHILSAHLGQERNESGQFNNEEQQFRCTWGECFKYEKPTPMRLRDCVRHMNTHILALLPSHES
KRGPKPWVIAAKTMSVAAEETMTVRDERNPNAPAQAAGIPLSAVLVLRNMARNLVKTEAEDELVKQRGERGGWNE
RLFRPLLPRLFEILAENRALAPYMASLLDLISSNDGDGDGDDDGD*
Coding >Ophcf2|01441
ATGACGGTCTCGCCGCAGGAGGCGCAGATGCACGCCATCGACCGCACTCCCGAGTATGAGGAGTTCATGACCAAG
CTGCGTGACTATCATGCGAGGCGCGGGACCACGCTCGATCCCGAACCCCGAGTAGGCGTCATTCATCTCGACCTC
TTCAAGGTCTTTAATCACATCGTCGCAAACGGCGGCTACGACAAGGTATCAGAGGAGAAGCTAGCCTGGCGCCGC
ATGGCTTCCGAGCTGGGCATCTTCTCCAATAACGAAGCCTCGACAGCCTTCTCCCTCAAGGAAAAGTTTTACAAG
AACCTGGCAGCTTTCGAGATCAGCACCATCCACGGAAAGGAGCCACCGCCCAAGGATATTCTCGAGGATGTCACG
GCAAAAGGCGCCAGCCTACTGACGCGTACACGCGACAACTTTCGCGGTAAACGCGACGTCAACGCCACCGATTCG
GCCGCTTCTGGAGACGACGGCACCCCAACGCGCGAGCGCCCTGCCGTGGAGAATCCCACGTCCAGCTCACGGGCT
TCCCGCGGTCTTCGTGAGGCGCCTCCCCAGCGAGTCATCTTCCAGCCAGACACGAGCTCCAGCCGGCCGACTAGA
CAAGCGACTAATCACCAGTCTGCCCCGACTCCCGCCCCGACCCAGCCGCCAATATCGGCAAATACCCCCCTCAGC
CTGCAGCCGATGCCGCCCCAGACCGGCCACCACCAGGCCGGCCATCACCCGGCCAGGCACGGCCCATCCATCGTC
CACCAACCGCCCAATGCAGAAGACACCTCTCAGCTGGTGCTCTCGTACCAGCCTAGGAACATGAGGCCACTGCAG
CTCCGCCCAGTAGCCACGCCCGGTTATGCTCCCGCCGAGTTCCCCAGACCTCGTCCGCCCCAGCGCCCGCCGCCC
CTCCATATCTCCGGCCGCCAGCCAATGTTGCCGGGAACTGGCTTCGATGGGCCTAATATATACACGCGCTGTCTC
ATGGCCCTGCGCAGCGGCCTCCCTGCCGAACAGGCCTTTGCCTTGAATCACTTGGTCAAGATATCGTATGAACGA
GGCGACAAGTACCGGTTCGACGCCTTCCCCGGGCTCGCCGAGGGTCTCGTCGGCAAGGCGCTTCACGTCGGCCGG
CTCTTCTACCACGTCGATTGGACCCTCTCCTGGGATCTTTACCCAGACTCGACCGATGTCGGTACTCTGGACGGC
AACAACGGCACGCCTGATATCCTCGAGAGGATTCAGGGTCTGGTGGAAAGAGACGTGCCAGAAGCGCTGCAGACT
GAGAAGTTTGCCGACGAGATGGTCCTCGTCACCGAGGCGGTCTTGACGATGCGAAATATGGTGACGCTGCCTGAC
AACGCCGTCAACATGTCCGACTTTCCCCCCCTCAAGGACCTGATTTGCATCCTCCTCCACTTGCCGGCCCACGAC
TCGCTCGTCGAGATGAAGCACCTGGCGTTGGACATTGCCGAGCAGCTGGCGCCTTACATGGCGCTCGAGGCCGAC
AATCCCCTCTACAAGACGCTGCTCTCCCAGCTCGGGTCCGAGGACCGCGGCATGATCCTGACGGCTCTACGGGCC
CTGGGACGCATCTCTATGAATCTCGAGGCGACCAACACGCTGGCCCATGTCAAGCCCGAGGCACTCCGGCGCATC
GTCAACTGGCTCCTCCTCAACGACGATGAGCTAATCGACGCCTGTCTCGACTTCCTATACCAGTATACTGCCGTG
GTGGCCAACCTGGACCATCTTGTGCGGTCTACGCGGCCGGAAGACGTCGTGGACCACCTTGTGCGTCTGTTGGCG
CATGGGGCTCGCAAGGTGCAGAGGGAGCTTATGCTGATGCCCGAACGGCGGCTGCCTTCGAGGGATGAGATTGCG
CCGATGCCCGAAGACCTGCTGCAGGAGATGGTGAAGCTGGAAGAGCCGGAGCGGGTGCACCGATGGGTCAAGTGC
TTCTTCGACGAGGACAACGGGTCATTCGTGACGCAGCTGGCGGCGTGGCAAGCCTATCAGTCGGCCTTTGCCGGG
CCGCTCAAGGACGCGGGCAAGGCCATGATCACGCCGGCCGACTTCATCCGGAGCAGCACGTCGGTGTACAAGAAC
TCGAACGCACAGGTGCTACGGGAGCCCGGCGAGGGGCAGCAAAAGTTCATCATCCACGGAATCCGGGCCCGGGCA
AGGCCGCTCAGCTTCGAGGGCGCAGAGTACGGGCGCTGCTTGTGGGCGACCAACGCGGAGAGGAAGAACGAGAAG
TGCGGACAGTTCTACCTCAAGCCGGAGCAGATGGCCGAACATATACTGTCGGCACACCTGGGCCAAGAACGCAAC
GAGTCGGGCCAGTTCAACAACGAGGAGCAGCAGTTCCGGTGCACTTGGGGGGAGTGCTTCAAGTACGAGAAGCCG
ACGCCCATGAGACTGCGCGACTGCGTCCGTCACATGAACACGCACATCCTGGCCCTGCTTCCTAGCCACGAGTCG
AAACGGGGACCGAAGCCGTGGGTGATTGCAGCCAAGACCATGTCAGTCGCCGCCGAGGAGACCATGACTGTCCGT
GACGAGCGGAACCCCAACGCTCCGGCCCAGGCAGCAGGCATCCCCCTGAGCGCCGTTCTGGTGCTGCGCAACATG
GCGCGCAACCTGGTCAAGACGGAGGCCGAGGACGAGCTCGTCAAGCAGCGAGGCGAACGAGGCGGTTGGAACGAG
AGGCTGTTCCGACCCCTACTGCCGCGGCTGTTTGAGATTCTCGCGGAGAACAGGGCGCTGGCTCCGTATATGGCA
TCGCTGCTGGACCTGATTAGCAGCAACGACGGCGACGGCGACGGCGACGACGACGGCGATTAA
Transcript >Ophcf2|01441
ATGACGGTCTCGCCGCAGGAGGCGCAGATGCACGCCATCGACCGCACTCCCGAGTATGAGGAGTTCATGACCAAG
CTGCGTGACTATCATGCGAGGCGCGGGACCACGCTCGATCCCGAACCCCGAGTAGGCGTCATTCATCTCGACCTC
TTCAAGGTCTTTAATCACATCGTCGCAAACGGCGGCTACGACAAGGTATCAGAGGAGAAGCTAGCCTGGCGCCGC
ATGGCTTCCGAGCTGGGCATCTTCTCCAATAACGAAGCCTCGACAGCCTTCTCCCTCAAGGAAAAGTTTTACAAG
AACCTGGCAGCTTTCGAGATCAGCACCATCCACGGAAAGGAGCCACCGCCCAAGGATATTCTCGAGGATGTCACG
GCAAAAGGCGCCAGCCTACTGACGCGTACACGCGACAACTTTCGCGGTAAACGCGACGTCAACGCCACCGATTCG
GCCGCTTCTGGAGACGACGGCACCCCAACGCGCGAGCGCCCTGCCGTGGAGAATCCCACGTCCAGCTCACGGGCT
TCCCGCGGTCTTCGTGAGGCGCCTCCCCAGCGAGTCATCTTCCAGCCAGACACGAGCTCCAGCCGGCCGACTAGA
CAAGCGACTAATCACCAGTCTGCCCCGACTCCCGCCCCGACCCAGCCGCCAATATCGGCAAATACCCCCCTCAGC
CTGCAGCCGATGCCGCCCCAGACCGGCCACCACCAGGCCGGCCATCACCCGGCCAGGCACGGCCCATCCATCGTC
CACCAACCGCCCAATGCAGAAGACACCTCTCAGCTGGTGCTCTCGTACCAGCCTAGGAACATGAGGCCACTGCAG
CTCCGCCCAGTAGCCACGCCCGGTTATGCTCCCGCCGAGTTCCCCAGACCTCGTCCGCCCCAGCGCCCGCCGCCC
CTCCATATCTCCGGCCGCCAGCCAATGTTGCCGGGAACTGGCTTCGATGGGCCTAATATATACACGCGCTGTCTC
ATGGCCCTGCGCAGCGGCCTCCCTGCCGAACAGGCCTTTGCCTTGAATCACTTGGTCAAGATATCGTATGAACGA
GGCGACAAGTACCGGTTCGACGCCTTCCCCGGGCTCGCCGAGGGTCTCGTCGGCAAGGCGCTTCACGTCGGCCGG
CTCTTCTACCACGTCGATTGGACCCTCTCCTGGGATCTTTACCCAGACTCGACCGATGTCGGTACTCTGGACGGC
AACAACGGCACGCCTGATATCCTCGAGAGGATTCAGGGTCTGGTGGAAAGAGACGTGCCAGAAGCGCTGCAGACT
GAGAAGTTTGCCGACGAGATGGTCCTCGTCACCGAGGCGGTCTTGACGATGCGAAATATGGTGACGCTGCCTGAC
AACGCCGTCAACATGTCCGACTTTCCCCCCCTCAAGGACCTGATTTGCATCCTCCTCCACTTGCCGGCCCACGAC
TCGCTCGTCGAGATGAAGCACCTGGCGTTGGACATTGCCGAGCAGCTGGCGCCTTACATGGCGCTCGAGGCCGAC
AATCCCCTCTACAAGACGCTGCTCTCCCAGCTCGGGTCCGAGGACCGCGGCATGATCCTGACGGCTCTACGGGCC
CTGGGACGCATCTCTATGAATCTCGAGGCGACCAACACGCTGGCCCATGTCAAGCCCGAGGCACTCCGGCGCATC
GTCAACTGGCTCCTCCTCAACGACGATGAGCTAATCGACGCCTGTCTCGACTTCCTATACCAGTATACTGCCGTG
GTGGCCAACCTGGACCATCTTGTGCGGTCTACGCGGCCGGAAGACGTCGTGGACCACCTTGTGCGTCTGTTGGCG
CATGGGGCTCGCAAGGTGCAGAGGGAGCTTATGCTGATGCCCGAACGGCGGCTGCCTTCGAGGGATGAGATTGCG
CCGATGCCCGAAGACCTGCTGCAGGAGATGGTGAAGCTGGAAGAGCCGGAGCGGGTGCACCGATGGGTCAAGTGC
TTCTTCGACGAGGACAACGGGTCATTCGTGACGCAGCTGGCGGCGTGGCAAGCCTATCAGTCGGCCTTTGCCGGG
CCGCTCAAGGACGCGGGCAAGGCCATGATCACGCCGGCCGACTTCATCCGGAGCAGCACGTCGGTGTACAAGAAC
TCGAACGCACAGGTGCTACGGGAGCCCGGCGAGGGGCAGCAAAAGTTCATCATCCACGGAATCCGGGCCCGGGCA
AGGCCGCTCAGCTTCGAGGGCGCAGAGTACGGGCGCTGCTTGTGGGCGACCAACGCGGAGAGGAAGAACGAGAAG
TGCGGACAGTTCTACCTCAAGCCGGAGCAGATGGCCGAACATATACTGTCGGCACACCTGGGCCAAGAACGCAAC
GAGTCGGGCCAGTTCAACAACGAGGAGCAGCAGTTCCGGTGCACTTGGGGGGAGTGCTTCAAGTACGAGAAGCCG
ACGCCCATGAGACTGCGCGACTGCGTCCGTCACATGAACACGCACATCCTGGCCCTGCTTCCTAGCCACGAGTCG
AAACGGGGACCGAAGCCGTGGGTGATTGCAGCCAAGACCATGTCAGTCGCCGCCGAGGAGACCATGACTGTCCGT
GACGAGCGGAACCCCAACGCTCCGGCCCAGGCAGCAGGCATCCCCCTGAGCGCCGTTCTGGTGCTGCGCAACATG
GCGCGCAACCTGGTCAAGACGGAGGCCGAGGACGAGCTCGTCAAGCAGCGAGGCGAACGAGGCGGTTGGAACGAG
AGGCTGTTCCGACCCCTACTGCCGCGGCTGTTTGAGATTCTCGCGGAGAACAGGGCGCTGGCTCCGTATATGGCA
TCGCTGCTGGACCTGATTAGCAGCAACGACGGCGACGGCGACGGCGACGACGACGGCGATTAA
Gene >Ophcf2|01441
ATGACGGTCTCGCCGCAGGAGGCGCAGATGCACGCCATCGACCGCACTCCCGAGTATGAGGAGTTCATGACCAAG
CTGCGTGACTATCATGCGAGGCGCGGGACCACGCTCGATCCCGAACCCCGAGTAGGCGTCATTCATCTCGACCTC
TTCAAGGTCTTTAATCACATCGTCGCAAACGGCGGCTACGACAAGGTATCAGAGGAGAAGCTAGCCTGGCGCCGC
ATGGCTTCCGAGCTGGGCATCTTCTCCAATAACGAAGCCTCGACAGCCTTCTCCCTCAAGGAAAAGTTTTACAAG
AACCTGGCAGCTTTCGAGATCAGCACCATCCACGGAAAGGAGCCACCGCCCAAGGATATTCTCGAGGATGTCACG
GCAAAAGGCGCCAGCCTACTGACGCGTACACGCGACAACTTTCGCGGTAAACGCGACGTCAACGCCACCGATTCG
GCCGCTTCTGGAGACGACGGCACCCCAACGCGCGAGCGCCCTGCCGTGGAGAATCCCACGTCCAGCTCACGGGCT
TCCCGCGGTCTTCGTGAGGCGCCTCCCCAGCGAGTCATCTTCCAGCCAGACACGAGCTCCAGCCGGCCGACTAGA
CAAGCGACTAATCACCAGTCTGCCCCGACTCCCGCCCCGACCCAGCCGCCAATATCGGCAAATACCCCCCTCAGC
CTGCAGCCGATGCCGCCCCAGACCGGCCACCACCAGGCCGGCCATCACCCGGCCAGGCACGGCCCATCCATCGTC
CACCAACCGCCCAATGCAGAAGACACCTCTCAGCTGGTGCTCTCGTACCAGCCTAGGAACATGAGGCCACTGCAG
CTCCGCCCAGTAGCCACGCCCGGTTATGCTCCCGCCGAGTTCCCCAGACCTCGTCCGCCCCAGCGCCCGCCGCCC
CTCCATATCTCCGGCCGCCAGCCAATGTTGCCGGGAAGTGAGTGCTTTGACCCAGACCGGGTCGGTGGATTCGCT
GACGCCAGGGGCTTTCCTCTTAGCTGGCTTCGATGGGCCTAATATATACACGCGCTGTCTCATGGCCCTGCGCAG
CGGCCTCCCTGCCGAACAGGCCTTTGCCTTGAATCACTTGGTCAAGATATCGTATGAACGAGGCGACAAGTACCG
GTTCGACGCCTTCCCCGGGCTCGCCGAGGGTCTCGTCGGCAAGGCGCTTCACGTCGGCCGGCTCTTCTACCACGT
CGATTGGACCCTCTCCTGGGATCTTTACCCAGACTCGACCGATGTCGGTACTCTGGACGGCAACAACGGCACGCC
TGATATCCTCGAGAGGATTCAGGGTCTGGTGGAAAGAGACGTGCCAGAAGCGCTGCAGACTGAGAAGTTTGCCGA
CGAGATGGTCCTCGTCACCGAGGCGGTCTTGACGATGCGAAATATGGTGACGCTGCCTGACAACGCCGTCAACAT
GTCCGACTTTCCCCCCCTCAAGGACCTGATTTGCATCCTCCTCCACTTGCCGGCCCACGACTCGCTCGTCGAGAT
GAAGCACCTGGCGTTGGACATTGCCGAGCAGCTGGCGCCTTACATGGCGCTCGAGGCCGACAATCCCCTCTACAA
GACGCTGCTCTCCCAGCTCGGGTCCGAGGACCGCGGCATGATCCTGACGGCTCTACGGGCCCTGGGACGCATCTC
TATGAATCTCGAGGCGACCAACACGCTGGCCCATGTCAAGCCCGAGGCACTCCGGCGCATCGTCAACTGGCTCCT
CCTCAACGACGATGAGCTAATCGACGCCTGTCTCGACTTCCTATACCAGTATACTGCCGTGGTGGCCAACCTGGA
CCATCTTGTGCGGTCTACGCGGCCGGAAGACGTCGTGGACCACCTTGTGCGTCTGTTGGCGCATGGGGCTCGCAA
GGTGCAGAGGGAGCTTATGCTGATGCCCGAACGGCGGCTGCCTTCGAGGGATGAGATTGCGCCGATGCCCGAAGA
CCTGCTGCAGGAGATGGTGAAGCTGGAAGAGCCGGAGCGGGTGCACCGATGGGTCAAGTGCTTCTTCGACGAGGA
CAACGGGTCATTCGTGACGCAGCTGGCGGCGTGGCAAGCCTATCAGTCGGCCTTTGCCGGGCCGCTCAAGGACGC
GGGCAAGGCCATGATCACGCCGGCCGACTTCATCCGGAGCAGCACGTCGGTGTACAAGAACTCGAACGCACAGGT
GCTACGGGAGCCCGGCGAGGGGCAGCAAAAGTTCATCATCCACGGAATCCGGGCCCGGGCAAGGCCGCTCAGCTT
CGAGGGCGCAGAGTACGGGCGCTGCTTGTGGGCGACCAACGCGGAGAGGAAGAACGAGAAGTGCGGACAGTTCTA
CCTCAAGCCGGAGCAGATGGCCGAACATATACTGTCGGCACACCTGGGCCAAGAACGCAACGAGTCGGGCCAGTT
CAACAACGAGGAGCAGCAGTTCCGGTGCACTTGGGGGGAGTGCTTCAAGTACGAGAAGCCGACGCCCATGAGACT
GCGCGACTGCGTCCGTCACATGAACACGCACATCCTGGCCCTGCTTCCTAGCCACGAGTCGAAACGGGGACCGAA
GCCGTGGGTGATTGCAGCCAAGACCATGTCAGTCGCCGCCGAGGAGACCATGACTGTCCGTGACGAGCGGAACCC
CAACGCTCCGGCCCAGGCAGCAGGCATCCCCCTGAGCGCCGTTCTGGTGCTGCGCAACATGGCGCGCAACCTGGT
CAAGACGGAGGCCGAGGACGAGCTCGTCAAGCAGCGAGGCGAACGAGGCGGTTGGAACGAGAGGCTGTTCCGACC
CCTACTGCCGCGGCTGTTTGAGATTCTCGCGGAGAACAGGGCGCTGGTGAGTTGAACGTGATGGCGAGAAGACGG
GATAAGACGGATTTTGCTGACAATTTTTCTTTTCTTTTTTTCTTCTTGTTTCTCGACCTCTAGGCTCCGTATATG
GCATCGCTGCTGGACCTGATTAGCAGCAACGACGGCGACGGCGACGGCGACGACGACGGCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail