Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01438
Gene name
Locationscaffold_01:4998602..5002993
Strand-
Gene length (bp)4391
Transcript length (bp)4065
Coding sequence length (bp)4065
Protein length (aa) 1355

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 5.6E-11 285 354
PF00013 KH_1 KH domain 2.4E-06 464 522
PF00013 KH_1 KH domain 4.0E-10 785 838
PF00013 KH_1 KH domain 8.7E-08 850 931
PF00013 KH_1 KH domain 3.1E-11 945 1007
PF00013 KH_1 KH domain 1.2E-10 1098 1159
PF00013 KH_1 KH domain 2.8E-12 1287 1342

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6015 0.5029 0.468 0.0669 0.1943 0.0447 0.106 0.0647 0.083 0.0167

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1586
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1996
Ophiocordyceps australis map64 (Brazil) OphauB2|7268
Ophiocordyceps camponoti-floridani Ophcf2|01438 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6316
Ophiocordyceps kimflemingae Ophio5|5512
Ophiocordyceps subramaniannii Hirsu2|1206

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01438
MSGRNFHLTLISAHRSITASPYAISAASLWFPPLLLVCSIGLRLVSTLSKVFFNSLQLDYLVGFNRHLCPSDLVT
SNMAASATDIVNGDASVAKKLLQKHAVTVEDVPDEDAPVKASGEASDMRAPPKVATQQKETPFKAPLDTQSHELF
PELGAPKGKSTNLTPIWGAKSSVNGASNNSSNGASRSSTPAPRAATPSNAATPSMFIPGRNVESVTLEPQFILPR
GQLKRPIQDVLKDINRKSRANVTMATASNGRLRFDATGSQDVAQQALKDLVQQIGTRTSIKVPIPHSARAHIIGK
GGSTIRALQEKTGAKVQLPKAEETRVPDDDDDDATIDVIVEGNALSAASARDEILRIAGERSANMQTKVRDIPVV
FYPFIAGPGNSLAQALEDSNGVQIRVPPHVAVARTAPPVAPGPGQRPVFVAAGADDDHIQLAGDRAAVQRARAEI
ERHVAELREQLEVEQLSIQRGRHQFIVGPRGVMADDFFTETGCAIVLPSEEEEDMVTVIGPADRVPAALDKAMDL
AMGMQMSNIDIARYHRNAPGGAAAHAGFVTRYLRHRREIDRIEQLYNTHINTPFSPEGALPWELYSRDGKNAIRA
QSEITGIINGHPPSRMQAVSIDPFFHQHLRNDIMPKVKKDFGVQMVVPEASESKAPVLLVYEGPNPAEGTYQVPR
SKPSDAEMRAFQQGLADAQKHILDLIARQETLSSASLDVPPNFHERLRRFIKKEQENRPSDQIPIRVTKVGTTIT
LRGPQTAVESLAAKAEAFVEQEKADEKERGFTLAFDFPQKYANHLIGKGGSNIRELRDRFNVEIQVQDGKVELKG
PRAKAEAARSHIQNLGRTLADETTHVLKIDPKYHRELIGAQGSQINRLQTRYKVLIFFPRTAKNAADDQSNADAA
SETGKPRRQQAPDEVVIRGPKKGADEARDEIFSLHKYLEEHSVTATVAIQQKQVGSLIGQGGAALDELRQATGAR
IDVPADRDAEIAEIFIKGTASQVAKARKVLEEKRAVFDDTIVEMIDVDKKFHKALIGPGGSNLRNMVVAAGGSDD
RRSLARTIQFPKQDADGNSIKVEGRTEVVHKIIERIREMVAEKERQVTEVVEVPIDNHRALIGRGGDIKRQMETQ
FGVSIDVPRQGDGKTGVKVTGRPEKVAMAKEHIAGIVKQQQGETMQVPRSLHHAVSNNGQIFRQLRNNHQVTVDH
AGQKVPAKSESSTRADKAALPLITDDAESAADAHSWKVMQTASGDEGDIAWVLRGTPDNVAKAKEVIQKALEQAQ
KNDWTGYLVLPDPKMYRHVIGPSGSKVSGIRQQSGCRIQVPWDQAKDEAIEIVGSRSGVEKAKDLVLAAVREAME
KARE*
Coding >Ophcf2|01438
ATGAGCGGGAGAAACTTCCACCTCACCCTCATCTCCGCCCATCGCTCCATCACTGCTTCGCCCTACGCCATCTCA
GCCGCTTCTCTCTGGTTTCCGCCGCTTCTTCTGGTCTGTTCTATTGGTCTCCGACTCGTTTCGACACTCTCAAAA
GTCTTTTTCAACTCCCTCCAATTAGACTATCTAGTTGGTTTCAACCGTCATCTCTGTCCATCGGATCTTGTCACC
TCGAACATGGCTGCCTCCGCCACTGATATCGTCAACGGTGACGCTTCCGTCGCCAAGAAGCTCCTCCAGAAACAC
GCCGTTACCGTCGAAGACGTCCCGGACGAGGATGCACCTGTCAAGGCGTCTGGCGAAGCTTCCGATATGCGAGCT
CCGCCCAAGGTTGCTACCCAGCAAAAGGAGACTCCCTTCAAAGCGCCCCTCGATACCCAGTCGCACGAGCTGTTC
CCCGAATTAGGAGCGCCCAAGGGCAAGAGTACCAATCTGACCCCTATCTGGGGCGCCAAGAGCAGCGTCAACGGC
GCGTCCAACAACTCTTCCAACGGCGCCTCGCGATCCTCGACGCCTGCCCCACGGGCCGCGACCCCTTCGAACGCT
GCCACGCCGTCCATGTTTATTCCAGGCCGCAACGTCGAGTCTGTCACTCTCGAGCCCCAGTTCATCTTGCCTCGA
GGCCAACTCAAACGGCCCATTCAGGATGTTCTCAAGGACATCAACCGTAAGTCCCGCGCAAACGTCACCATGGCG
ACGGCCTCCAATGGTCGGCTGCGATTTGATGCCACCGGGTCTCAGGACGTTGCCCAACAGGCACTCAAGGATTTG
GTTCAGCAAATTGGCACCAGAACTTCCATCAAGGTCCCTATTCCTCATAGCGCGCGCGCTCACATCATCGGCAAG
GGTGGCTCGACCATCCGCGCCTTACAAGAGAAGACTGGGGCCAAAGTCCAGCTACCCAAAGCCGAGGAAACTCGC
GTCCCGGACGATGACGATGACGACGCTACGATCGATGTCATCGTCGAGGGCAATGCGCTCTCTGCCGCATCCGCT
CGGGACGAAATCCTCAGGATTGCGGGCGAACGATCAGCTAACATGCAGACAAAAGTACGCGACATCCCGGTCGTC
TTTTATCCCTTCATCGCTGGGCCCGGAAACTCTCTGGCCCAAGCTCTGGAAGATAGCAACGGCGTGCAGATCCGC
GTCCCACCCCACGTGGCCGTGGCCCGGACCGCGCCGCCGGTGGCGCCCGGACCTGGCCAGCGACCCGTTTTTGTC
GCTGCCGGAGCCGACGACGACCACATCCAGCTCGCCGGTGACCGGGCTGCCGTTCAGCGTGCGCGTGCCGAGATT
GAGCGCCACGTTGCCGAGCTCCGTGAGCAGCTCGAAGTGGAGCAGCTGTCCATCCAAAGAGGGCGACACCAGTTC
ATTGTTGGTCCTCGTGGTGTCATGGCCGACGACTTCTTTACCGAGACGGGATGTGCCATCGTGCTGCCTTCGGAG
GAGGAGGAAGATATGGTAACCGTCATCGGGCCCGCCGACCGCGTACCGGCTGCTCTCGACAAGGCCATGGATCTT
GCCATGGGGATGCAAATGTCTAACATTGACATCGCCAGATATCATCGCAACGCCCCCGGTGGCGCTGCCGCCCAT
GCGGGCTTCGTCACTCGCTATCTGCGGCACCGCAGGGAGATTGATCGCATCGAACAGCTATACAATACGCACATC
AACACGCCCTTCTCTCCTGAAGGCGCCTTGCCATGGGAGTTGTATTCACGCGACGGGAAGAACGCTATCCGGGCT
CAGTCCGAAATCACTGGCATCATCAACGGTCATCCTCCGTCGCGCATGCAGGCTGTTTCCATTGACCCCTTCTTT
CACCAGCATCTCCGCAACGACATCATGCCCAAGGTGAAGAAAGACTTTGGCGTTCAGATGGTCGTTCCCGAGGCT
TCCGAGTCCAAGGCCCCCGTTCTTTTAGTCTACGAAGGCCCGAATCCCGCCGAAGGGACCTATCAGGTTCCGCGC
TCGAAGCCATCGGATGCGGAGATGCGAGCTTTCCAGCAGGGCCTTGCGGACGCGCAGAAACATATCCTCGACCTC
ATCGCCAGGCAAGAGACCCTCTCTAGCGCTTCTCTCGATGTGCCGCCCAATTTCCACGAGAGGCTCCGCAGATTC
ATCAAGAAGGAACAGGAAAACAGGCCTTCAGACCAGATTCCCATCAGGGTGACCAAGGTTGGTACGACGATCACG
CTCCGAGGCCCTCAGACAGCCGTCGAGTCGTTGGCGGCAAAAGCCGAGGCCTTTGTGGAGCAGGAAAAAGCAGAT
GAAAAGGAGCGTGGCTTCACCTTGGCCTTTGATTTTCCCCAGAAGTACGCGAATCACCTCATCGGCAAGGGCGGC
AGCAACATCAGGGAGCTCCGTGACCGCTTCAACGTCGAGATTCAGGTACAAGACGGCAAAGTCGAGCTCAAGGGC
CCGCGGGCCAAGGCCGAGGCAGCGCGGTCTCACATCCAGAATCTAGGACGCACTCTGGCGGATGAGACGACGCAC
GTGTTGAAGATCGACCCCAAGTATCACAGGGAGCTCATAGGGGCCCAAGGAAGCCAGATCAACCGGCTTCAGACC
AGATACAAGGTTCTCATCTTCTTCCCGCGAACCGCCAAGAACGCCGCCGATGACCAGTCCAACGCCGACGCAGCG
AGCGAGACCGGGAAGCCCCGTCGGCAGCAAGCGCCTGACGAGGTAGTGATCCGCGGCCCTAAGAAGGGCGCGGAC
GAGGCCAGGGACGAGATCTTCTCCCTCCACAAGTATCTCGAGGAGCACTCCGTCACGGCGACGGTGGCCATTCAG
CAGAAGCAGGTCGGGTCGCTAATAGGTCAGGGTGGTGCTGCCTTGGATGAGTTGCGACAGGCCACCGGTGCCCGG
ATCGACGTTCCGGCCGATCGCGACGCGGAGATTGCCGAGATCTTCATCAAGGGCACCGCGTCTCAGGTAGCCAAG
GCACGCAAGGTTCTGGAGGAGAAGCGTGCCGTCTTTGACGACACCATTGTGGAGATGATTGATGTGGACAAGAAG
TTCCACAAGGCTCTCATCGGCCCCGGAGGATCCAACCTCAGGAACATGGTTGTGGCGGCGGGCGGCTCGGACGAT
CGACGCAGCCTGGCACGGACGATTCAGTTCCCGAAGCAAGACGCCGACGGCAATTCGATCAAGGTGGAAGGCCGG
ACGGAGGTTGTGCACAAAATCATTGAGCGAATCCGCGAGATGGTTGCGGAAAAGGAGAGGCAGGTGACGGAGGTG
GTGGAGGTGCCCATTGATAACCACAGGGCCTTGATCGGGCGTGGCGGCGACATCAAGCGTCAGATGGAGACGCAG
TTTGGGGTATCGATTGATGTGCCTCGGCAGGGCGACGGAAAGACGGGCGTCAAGGTGACGGGTCGACCTGAGAAG
GTGGCCATGGCCAAGGAGCACATCGCGGGCATCGTCAAGCAGCAGCAGGGGGAGACGATGCAGGTCCCGCGCAGC
CTCCACCACGCCGTGTCGAACAACGGACAGATCTTCCGCCAGCTGCGGAATAACCACCAGGTGACGGTGGATCAT
GCCGGCCAGAAGGTGCCGGCCAAGTCGGAATCATCGACGCGTGCGGACAAGGCAGCGCTCCCACTCATCACGGAC
GATGCCGAGAGCGCGGCCGACGCTCACTCGTGGAAGGTGATGCAGACGGCGTCTGGCGACGAGGGGGATATTGCC
TGGGTTCTCAGGGGCACACCGGACAACGTGGCCAAGGCCAAGGAGGTGATCCAGAAGGCGCTGGAGCAGGCGCAG
AAGAACGACTGGACGGGCTACCTGGTGCTTCCCGACCCGAAGATGTATCGCCATGTCATCGGTCCGAGCGGCTCC
AAGGTCAGCGGTATCCGCCAGCAGAGCGGCTGCAGGATCCAAGTGCCATGGGACCAGGCCAAGGACGAGGCCATC
GAGATCGTCGGTAGCCGGAGCGGAGTGGAAAAGGCCAAGGATCTGGTGCTTGCAGCGGTTCGGGAGGCAATGGAA
AAGGCTAGAGAATAA
Transcript >Ophcf2|01438
ATGAGCGGGAGAAACTTCCACCTCACCCTCATCTCCGCCCATCGCTCCATCACTGCTTCGCCCTACGCCATCTCA
GCCGCTTCTCTCTGGTTTCCGCCGCTTCTTCTGGTCTGTTCTATTGGTCTCCGACTCGTTTCGACACTCTCAAAA
GTCTTTTTCAACTCCCTCCAATTAGACTATCTAGTTGGTTTCAACCGTCATCTCTGTCCATCGGATCTTGTCACC
TCGAACATGGCTGCCTCCGCCACTGATATCGTCAACGGTGACGCTTCCGTCGCCAAGAAGCTCCTCCAGAAACAC
GCCGTTACCGTCGAAGACGTCCCGGACGAGGATGCACCTGTCAAGGCGTCTGGCGAAGCTTCCGATATGCGAGCT
CCGCCCAAGGTTGCTACCCAGCAAAAGGAGACTCCCTTCAAAGCGCCCCTCGATACCCAGTCGCACGAGCTGTTC
CCCGAATTAGGAGCGCCCAAGGGCAAGAGTACCAATCTGACCCCTATCTGGGGCGCCAAGAGCAGCGTCAACGGC
GCGTCCAACAACTCTTCCAACGGCGCCTCGCGATCCTCGACGCCTGCCCCACGGGCCGCGACCCCTTCGAACGCT
GCCACGCCGTCCATGTTTATTCCAGGCCGCAACGTCGAGTCTGTCACTCTCGAGCCCCAGTTCATCTTGCCTCGA
GGCCAACTCAAACGGCCCATTCAGGATGTTCTCAAGGACATCAACCGTAAGTCCCGCGCAAACGTCACCATGGCG
ACGGCCTCCAATGGTCGGCTGCGATTTGATGCCACCGGGTCTCAGGACGTTGCCCAACAGGCACTCAAGGATTTG
GTTCAGCAAATTGGCACCAGAACTTCCATCAAGGTCCCTATTCCTCATAGCGCGCGCGCTCACATCATCGGCAAG
GGTGGCTCGACCATCCGCGCCTTACAAGAGAAGACTGGGGCCAAAGTCCAGCTACCCAAAGCCGAGGAAACTCGC
GTCCCGGACGATGACGATGACGACGCTACGATCGATGTCATCGTCGAGGGCAATGCGCTCTCTGCCGCATCCGCT
CGGGACGAAATCCTCAGGATTGCGGGCGAACGATCAGCTAACATGCAGACAAAAGTACGCGACATCCCGGTCGTC
TTTTATCCCTTCATCGCTGGGCCCGGAAACTCTCTGGCCCAAGCTCTGGAAGATAGCAACGGCGTGCAGATCCGC
GTCCCACCCCACGTGGCCGTGGCCCGGACCGCGCCGCCGGTGGCGCCCGGACCTGGCCAGCGACCCGTTTTTGTC
GCTGCCGGAGCCGACGACGACCACATCCAGCTCGCCGGTGACCGGGCTGCCGTTCAGCGTGCGCGTGCCGAGATT
GAGCGCCACGTTGCCGAGCTCCGTGAGCAGCTCGAAGTGGAGCAGCTGTCCATCCAAAGAGGGCGACACCAGTTC
ATTGTTGGTCCTCGTGGTGTCATGGCCGACGACTTCTTTACCGAGACGGGATGTGCCATCGTGCTGCCTTCGGAG
GAGGAGGAAGATATGGTAACCGTCATCGGGCCCGCCGACCGCGTACCGGCTGCTCTCGACAAGGCCATGGATCTT
GCCATGGGGATGCAAATGTCTAACATTGACATCGCCAGATATCATCGCAACGCCCCCGGTGGCGCTGCCGCCCAT
GCGGGCTTCGTCACTCGCTATCTGCGGCACCGCAGGGAGATTGATCGCATCGAACAGCTATACAATACGCACATC
AACACGCCCTTCTCTCCTGAAGGCGCCTTGCCATGGGAGTTGTATTCACGCGACGGGAAGAACGCTATCCGGGCT
CAGTCCGAAATCACTGGCATCATCAACGGTCATCCTCCGTCGCGCATGCAGGCTGTTTCCATTGACCCCTTCTTT
CACCAGCATCTCCGCAACGACATCATGCCCAAGGTGAAGAAAGACTTTGGCGTTCAGATGGTCGTTCCCGAGGCT
TCCGAGTCCAAGGCCCCCGTTCTTTTAGTCTACGAAGGCCCGAATCCCGCCGAAGGGACCTATCAGGTTCCGCGC
TCGAAGCCATCGGATGCGGAGATGCGAGCTTTCCAGCAGGGCCTTGCGGACGCGCAGAAACATATCCTCGACCTC
ATCGCCAGGCAAGAGACCCTCTCTAGCGCTTCTCTCGATGTGCCGCCCAATTTCCACGAGAGGCTCCGCAGATTC
ATCAAGAAGGAACAGGAAAACAGGCCTTCAGACCAGATTCCCATCAGGGTGACCAAGGTTGGTACGACGATCACG
CTCCGAGGCCCTCAGACAGCCGTCGAGTCGTTGGCGGCAAAAGCCGAGGCCTTTGTGGAGCAGGAAAAAGCAGAT
GAAAAGGAGCGTGGCTTCACCTTGGCCTTTGATTTTCCCCAGAAGTACGCGAATCACCTCATCGGCAAGGGCGGC
AGCAACATCAGGGAGCTCCGTGACCGCTTCAACGTCGAGATTCAGGTACAAGACGGCAAAGTCGAGCTCAAGGGC
CCGCGGGCCAAGGCCGAGGCAGCGCGGTCTCACATCCAGAATCTAGGACGCACTCTGGCGGATGAGACGACGCAC
GTGTTGAAGATCGACCCCAAGTATCACAGGGAGCTCATAGGGGCCCAAGGAAGCCAGATCAACCGGCTTCAGACC
AGATACAAGGTTCTCATCTTCTTCCCGCGAACCGCCAAGAACGCCGCCGATGACCAGTCCAACGCCGACGCAGCG
AGCGAGACCGGGAAGCCCCGTCGGCAGCAAGCGCCTGACGAGGTAGTGATCCGCGGCCCTAAGAAGGGCGCGGAC
GAGGCCAGGGACGAGATCTTCTCCCTCCACAAGTATCTCGAGGAGCACTCCGTCACGGCGACGGTGGCCATTCAG
CAGAAGCAGGTCGGGTCGCTAATAGGTCAGGGTGGTGCTGCCTTGGATGAGTTGCGACAGGCCACCGGTGCCCGG
ATCGACGTTCCGGCCGATCGCGACGCGGAGATTGCCGAGATCTTCATCAAGGGCACCGCGTCTCAGGTAGCCAAG
GCACGCAAGGTTCTGGAGGAGAAGCGTGCCGTCTTTGACGACACCATTGTGGAGATGATTGATGTGGACAAGAAG
TTCCACAAGGCTCTCATCGGCCCCGGAGGATCCAACCTCAGGAACATGGTTGTGGCGGCGGGCGGCTCGGACGAT
CGACGCAGCCTGGCACGGACGATTCAGTTCCCGAAGCAAGACGCCGACGGCAATTCGATCAAGGTGGAAGGCCGG
ACGGAGGTTGTGCACAAAATCATTGAGCGAATCCGCGAGATGGTTGCGGAAAAGGAGAGGCAGGTGACGGAGGTG
GTGGAGGTGCCCATTGATAACCACAGGGCCTTGATCGGGCGTGGCGGCGACATCAAGCGTCAGATGGAGACGCAG
TTTGGGGTATCGATTGATGTGCCTCGGCAGGGCGACGGAAAGACGGGCGTCAAGGTGACGGGTCGACCTGAGAAG
GTGGCCATGGCCAAGGAGCACATCGCGGGCATCGTCAAGCAGCAGCAGGGGGAGACGATGCAGGTCCCGCGCAGC
CTCCACCACGCCGTGTCGAACAACGGACAGATCTTCCGCCAGCTGCGGAATAACCACCAGGTGACGGTGGATCAT
GCCGGCCAGAAGGTGCCGGCCAAGTCGGAATCATCGACGCGTGCGGACAAGGCAGCGCTCCCACTCATCACGGAC
GATGCCGAGAGCGCGGCCGACGCTCACTCGTGGAAGGTGATGCAGACGGCGTCTGGCGACGAGGGGGATATTGCC
TGGGTTCTCAGGGGCACACCGGACAACGTGGCCAAGGCCAAGGAGGTGATCCAGAAGGCGCTGGAGCAGGCGCAG
AAGAACGACTGGACGGGCTACCTGGTGCTTCCCGACCCGAAGATGTATCGCCATGTCATCGGTCCGAGCGGCTCC
AAGGTCAGCGGTATCCGCCAGCAGAGCGGCTGCAGGATCCAAGTGCCATGGGACCAGGCCAAGGACGAGGCCATC
GAGATCGTCGGTAGCCGGAGCGGAGTGGAAAAGGCCAAGGATCTGGTGCTTGCAGCGGTTCGGGAGGCAATGGAA
AAGGCTAGAGAATAA
Gene >Ophcf2|01438
ATGAGCGGGAGAAACTTCCACCTCACCCTCATCTCCGCCCATCGCTCCATCACTGCTTCGCCCTACGCCATCTCA
GCCGCTTCTCTCTGGTTTCCGCCGCTTCTTCTGGTCTGTTCTATTGGTCTCCGGTAATCATCATCTGTTGGTGGG
CAGCATCATGCTGTAGCGATTCTCGACTCCTTGAACAACGCCATCGCCGCCTTCTGTCCGCCCACCGAGAAGGAG
AGAGATATCCTACCTATTCGCAGACACATTCGCACTTTTCTGAACGCTTTCAGACTCGTTTCGACACTCTCAAAA
GTCTTGCAAGTCTTTCCTCGAGCTGCTCAGCCAGCGACAATCTGCTAACTCGTCAGCTGTAGTTTCAACTCCCTC
CAATTAGACTATCTAGTTGGTTTCAACCGTCATCTCTGTCCATCGGATCTTGTCACCTCGAACATGGCTGCCTCC
GCCACTGATATCGTCAACGGTGACGCTTCCGTCGCCAAGAAGCTCCTCCAGAAACACGCCGTTACCGTCGAAGAC
GTCCCGGACGAGGATGCACCTGTCAAGGCGTCTGGCGAAGCTTCCGATATGCGAGCTCCGCCCAAGGTTGCTACC
CAGCAAAAGGAGACTCCCTTCAAAGCGCCCCTCGATACCCAGTCGCACGAGCTGTTCCCCGAATTAGGAGCGCCC
AAGGGCAAGAGTACCAATCTGACCCCTATCTGGGGCGCCAAGAGCAGCGTCAACGGCGCGTCCAACAACTCTTCC
AACGGCGCCTCGCGATCCTCGACGCCTGCCCCACGGGCCGCGACCCCTTCGAACGCTGCCACGCCGTCCATGTTT
ATTCCAGGCCGCAACGTCGAGTCTGTCACTCTCGAGCCCCAGTTCATCTTGCCTCGAGGCCAACTCAAACGGCCC
ATTCAGGATGTTCTCAAGGACATCAACCGTAAGTCCCGCGCAAACGTCACCATGGCGACGGCCTCCAATGGTCGG
CTGCGATTTGATGCCACCGGGTCTCAGGACGTTGCCCAACAGGCACTCAAGGATTTGGTTCAGCAAATTGGCACC
AGAGTCAGCTCACCGCTCCATGACTCCCCTCTACGAGTAGTCAGTCATCTTGCTAATTACGTACTAGACTTCCAT
CAAGGTCCCTATTCCTCATAGCGCGCGCGCTCACATCATCGGCAAGGGTGGCTCGACCATCCGCGCCTTACAAGA
GAAGACTGGGGCCAAAGTCCAGCTACCCAAAGCCGAGGAAACTCGCGTCCCGGACGATGACGATGACGACGCTAC
GATCGATGTCATCGTCGAGGGCAATGCGCTCTCTGCCGCATCCGCTCGGGACGAAATCCTCAGGATTGCGGGCGA
ACGATCAGCTAACATGCAGACAAAAGTACGCGACATCCCGGTCGTCTTTTATCCCTTCATCGCTGGGCCCGGAAA
CTCTCTGGCCCAAGCTCTGGAAGATAGCAACGGCGTGCAGATCCGCGTCCCACCCCACGTGGCCGTGGCCCGGAC
CGCGCCGCCGGTGGCGCCCGGACCTGGCCAGCGACCCGTTTTTGTCGCTGCCGGAGCCGACGACGACCACATCCA
GCTCGCCGGTGACCGGGCTGCCGTTCAGCGTGCGCGTGCCGAGATTGAGCGCCACGTTGCCGAGCTCCGTGAGCA
GCTCGAAGTGGAGCAGCTGTCCATCCAAAGAGGGCGACACCAGTTCATTGTTGGTCCTCGTGGTGTCATGGCCGA
CGACTTCTTTACCGAGACGGGATGTGCCATCGTGCTGCCTTCGGAGGAGGAGGAAGATATGGTAACCGTCATCGG
GCCCGCCGACCGCGTACCGGCTGCTCTCGACAAGGCCATGGATCTTGCCATGGGGATGCAAATGTCTAACATTGA
CATCGCCAGATATCATCGCAACGCCCCCGGTGGCGCTGCCGCCCATGCGGGCTTCGTCACTCGCTATCTGCGGCA
CCGCAGGGAGATTGATCGCATCGAACAGCTATACAATACGCACATCAACACGCCCTTCTCTCCTGAAGGCGCCTT
GCCATGGGAGTTGTATTCACGCGACGGGAAGAACGCTATCCGGGCTCAGTCCGAAATCACTGGCATCATCAACGG
TCATCCTCCGTCGCGCATGCAGGCTGTTTCCATTGACCCCTTCTTTCACCAGCATCTCCGCAACGACATCATGCC
CAAGGTGAAGAAAGACTTTGGCGTTCAGATGGTCGTTCCCGAGGCTTCCGAGTCCAAGGCCCCCGTTCTTTTAGT
CTACGAAGGCCCGAATCCCGCCGAAGGGACCTATCAGGTTCCGCGCTCGAAGCCATCGGATGCGGAGATGCGAGC
TTTCCAGCAGGGCCTTGCGGACGCGCAGAAACATATCCTCGACCTCATCGCCAGGCAAGAGACCCTCTCTAGCGC
TTCTCTCGATGTGCCGCCCAATTTCCACGAGAGGCTCCGCAGATTCATCAAGAAGGAACAGGAAAACAGGCCTTC
AGACCAGATTCCCATCAGGGTGACCAAGGTTGGTACGACGATCACGCTCCGAGGCCCTCAGACAGCCGTCGAGTC
GTTGGCGGCAAAAGCCGAGGCCTTTGTGGAGCAGGAAAAAGCAGATGAAAAGGAGCGTGGCTTCACCTTGGCCTT
TGATTTTCCCCAGAAGTACGCGAATCACCTCATCGGCAAGGGCGGCAGCAACATCAGGGAGCTCCGTGACCGCTT
CAACGTCGAGATTCAGGTACAAGACGGCAAAGTCGAGCTCAAGGGCCCGCGGGCCAAGGCCGAGGCAGCGCGGTC
TCACATCCAGAATCTAGGACGCACTCTGGCGGATGAGACGACGCACGTGTTGAAGATCGACCCCAAGTATCACAG
GGAGCTCATAGGGGCCCAAGGAAGCCAGATCAACCGGCTTCAGACCAGATACAAGGTTCTCATCTTCTTCCCGCG
AACCGCCAAGAACGCCGCCGATGACCAGTCCAACGCCGACGCAGCGAGCGAGACCGGGAAGCCCCGTCGGCAGCA
AGCGCCTGACGAGGTAGTGATCCGCGGCCCTAAGAAGGGCGCGGACGAGGCCAGGGACGAGATCTTCTCCCTCCA
CAAGTATCTCGAGGAGCACTCCGTCACGGCGACGGTGGCCATTCAGCAGAAGCAGGTCGGGTCGCTAATAGGTCA
GGGTGGTGCTGCCTTGGATGAGTTGCGACAGGCCACCGGTGCCCGGATCGACGTTCCGGCCGATCGCGACGCGGA
GATTGCCGAGATCTTCATCAAGGGCACCGCGTCTCAGGTAGCCAAGGCACGCAAGGTTCTGGAGGAGAAGCGTGC
CGTCTTTGACGACACCATTGTGGAGATGATTGATGTGGACAAGAAGTTCCACAAGGCTCTCATCGGCCCCGGAGG
TGAGTGGAGTTCGTACGAGAGTCCCTCGATGCCGGCTTTCTAACGCAAATATAGGATCCAACCTCAGGAACATGG
TTGTGGCGGCGGGCGGCTCGGACGATCGACGCAGCCTGGCACGGACGATTCAGTTCCCGAAGCAAGACGCCGACG
GCAATTCGATCAAGGTGGAAGGCCGGACGGAGGTTGTGCACAAAATCATTGAGCGAATCCGCGAGATGGTTGCGG
AAAAGGAGAGGCAGGTGACGGAGGTGGTGGAGGTGCCCATTGATAACCACAGGGCCTTGATCGGGCGTGGCGGCG
ACATCAAGCGTCAGATGGAGACGCAGTTTGGGGTATCGATTGATGTGCCTCGGCAGGGCGACGGAAAGACGGGCG
TCAAGGTGACGGGTCGACCTGAGAAGGTGGCCATGGCCAAGGAGCACATCGCGGGCATCGTCAAGCAGCAGCAGG
GGGAGACGATGCAGGTCCCGCGCAGCCTCCACCACGCCGTGTCGAACAACGGACAGATCTTCCGCCAGCTGCGGA
ATAACCACCAGGTGACGGTGGATCATGCCGGCCAGAAGGTGCCGGCCAAGTCGGAATCATCGACGCGTGCGGACA
AGGCAGCGCTCCCACTCATCACGGACGATGCCGAGAGCGCGGCCGACGCTCACTCGTGGAAGGTGATGCAGACGG
CGTCTGGCGACGAGGGGGATATTGCCTGGGTTCTCAGGGGCACACCGGACAACGTGGCCAAGGCCAAGGAGGTGA
TCCAGAAGGCGCTGGAGCAGGCGCAGAAGAACGACTGGACGGGCTACCTGGTGCTTCCCGACCCGAAGATGTATC
GCCATGTCATCGGTCCGAGCGGCTCCAAGGTCAGCGGTATCCGCCAGCAGAGCGGCTGCAGGATCCAAGTGCCAT
GGGACCAGGCCAAGGACGAGGCCATCGAGATCGTCGGTAGCCGGAGCGGAGTGGAAAAGGCCAAGGATCTGGTGC
TTGCAGCGGTTCGGGAGGCAATGGAAAAGGCTAGAGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail