Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01431
Gene name
Locationscaffold_01:4985895..4986942
Strand+
Gene length (bp)1047
Transcript length (bp)930
Coding sequence length (bp)930
Protein length (aa) 310

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00775 Dioxygenase_C Dioxygenase 2.8E-42 121 301
PF04444 Dioxygenase_N Catechol dioxygenase N terminus 2.1E-25 39 110

GO

GO Term Description Terminal node
GO:0018576 catechol 1,2-dioxygenase activity Yes
GO:0008199 ferric iron binding Yes
GO:0005506 iron ion binding Yes
GO:0003824 catalytic activity Yes
GO:0006725 cellular aromatic compound metabolic process Yes
GO:0009712 catechol-containing compound metabolic process Yes
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0016491 oxidoreductase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0046914 transition metal ion binding No
GO:0051213 dioxygenase activity No
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen No
GO:0018958 phenol-containing compound metabolic process No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:1901615 organic hydroxy compound metabolic process No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0019114 catechol dioxygenase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7043 0.4663 0.1949 0.1174 0.2269 0.0915 0.093 0.175 0.0598 0.0857

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup174
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4368
Ophiocordyceps australis 1348a (Ghana) OphauG2|6199
Ophiocordyceps australis map64 (Brazil) OphauB2|5336
Ophiocordyceps australis map64 (Brazil) OphauB2|6668
Ophiocordyceps camponoti-floridani Ophcf2|01431 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|05279
Ophiocordyceps camponoti-rufipedis Ophun1|7069
Ophiocordyceps camponoti-rufipedis Ophun1|7455
Ophiocordyceps kimflemingae Ophio5|4134
Ophiocordyceps kimflemingae Ophio5|6871
Ophiocordyceps subramaniannii Hirsu2|2220
Ophiocordyceps subramaniannii Hirsu2|4230

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01431
MQQRMAQVNGKVPVSEPTSRFDPAFTKHVIDTMGPDVSPRTRLVLSSLLRHLHDFAREVELTNEEWMAGVHFVNS
IGAVSTPERNEAHRVSDVLGLESLVDEIANKVVAQDGDADPTSSSILGPFWSPNAPFRPNGSSIIQDPAPGGRTC
RMHGTISDLATGKPIPGAVFDLWQASTNGCYDFQDPEGQTPNNLRGKFTADEQGRYSLICLHPTAYSLPTDGPSY
RLLRLMDRHPMRPAHIHIRVTHPDYRGCTTQLYPRHDPYLATDTVFAVKDDLVVDFEPLVGDGEAELGLEYNVFL
TPKGYKSRY*
Coding >Ophcf2|01431
ATGCAACAAAGAATGGCTCAAGTCAACGGCAAGGTCCCCGTCAGCGAGCCGACGAGCCGCTTCGACCCGGCCTTT
ACCAAGCACGTCATCGACACCATGGGCCCGGACGTGTCGCCGCGGACTAGGCTCGTGCTTTCGAGTCTGCTGCGG
CATCTGCATGACTTTGCGAGAGAGGTTGAGTTGACGAATGAGGAGTGGATGGCGGGTGTGCACTTTGTGAACTCC
ATCGGTGCTGTTTCTACGCCGGAGCGCAACGAGGCGCATCGTGTGTCGGATGTTTTGGGGCTGGAATCGCTGGTG
GATGAAATCGCAAACAAGGTCGTCGCTCAGGACGGAGACGCCGACCCGACTTCTTCCTCCATCCTCGGCCCCTTT
TGGTCTCCCAACGCTCCCTTCCGTCCCAACGGTTCGTCCATCATCCAGGATCCGGCTCCGGGGGGGCGCACGTGC
CGGATGCACGGCACCATCTCGGACCTCGCCACGGGGAAGCCTATCCCCGGAGCCGTCTTCGATCTCTGGCAGGCC
AGCACCAACGGCTGCTACGACTTTCAGGATCCGGAGGGTCAGACGCCGAATAACCTGAGGGGCAAGTTCACGGCG
GATGAGCAGGGACGGTACAGCCTCATCTGTCTGCATCCTACGGCCTACTCGCTGCCGACGGACGGTCCGAGCTAT
CGATTGCTGCGGCTGATGGATCGGCATCCCATGCGGCCAGCGCATATCCACATCCGGGTGACGCATCCGGATTAT
AGGGGCTGCACGACGCAGCTTTACCCGCGCCATGACCCGTATCTGGCGACGGATACCGTGTTTGCTGTCAAGGAC
GATCTGGTGGTTGACTTTGAGCCGCTGGTTGGAGATGGTGAGGCCGAATTGGGGCTCGAATACAACGTGTTTCTG
ACGCCCAAGGGGTATAAGAGCCGTTATTGA
Transcript >Ophcf2|01431
ATGCAACAAAGAATGGCTCAAGTCAACGGCAAGGTCCCCGTCAGCGAGCCGACGAGCCGCTTCGACCCGGCCTTT
ACCAAGCACGTCATCGACACCATGGGCCCGGACGTGTCGCCGCGGACTAGGCTCGTGCTTTCGAGTCTGCTGCGG
CATCTGCATGACTTTGCGAGAGAGGTTGAGTTGACGAATGAGGAGTGGATGGCGGGTGTGCACTTTGTGAACTCC
ATCGGTGCTGTTTCTACGCCGGAGCGCAACGAGGCGCATCGTGTGTCGGATGTTTTGGGGCTGGAATCGCTGGTG
GATGAAATCGCAAACAAGGTCGTCGCTCAGGACGGAGACGCCGACCCGACTTCTTCCTCCATCCTCGGCCCCTTT
TGGTCTCCCAACGCTCCCTTCCGTCCCAACGGTTCGTCCATCATCCAGGATCCGGCTCCGGGGGGGCGCACGTGC
CGGATGCACGGCACCATCTCGGACCTCGCCACGGGGAAGCCTATCCCCGGAGCCGTCTTCGATCTCTGGCAGGCC
AGCACCAACGGCTGCTACGACTTTCAGGATCCGGAGGGTCAGACGCCGAATAACCTGAGGGGCAAGTTCACGGCG
GATGAGCAGGGACGGTACAGCCTCATCTGTCTGCATCCTACGGCCTACTCGCTGCCGACGGACGGTCCGAGCTAT
CGATTGCTGCGGCTGATGGATCGGCATCCCATGCGGCCAGCGCATATCCACATCCGGGTGACGCATCCGGATTAT
AGGGGCTGCACGACGCAGCTTTACCCGCGCCATGACCCGTATCTGGCGACGGATACCGTGTTTGCTGTCAAGGAC
GATCTGGTGGTTGACTTTGAGCCGCTGGTTGGAGATGGTGAGGCCGAATTGGGGCTCGAATACAACGTGTTTCTG
ACGCCCAAGGGGTATAAGAGCCGTTATTGA
Gene >Ophcf2|01431
ATGCAACAAAGAATGGCTCAAGTCAACGGCAAGGTCCCCGTCAGCGAGCCGACGAGCCGCTTCGACCCGGCCTTT
ACCAAGCACGTCATCGACACCATGGGCCCGGACGTGTCGCCGCGGACTAGGCTCGTGCTTTCGAGTCTGCTGCGG
CATCTGCATGACTTTGCGAGAGAGGTTGAGTTGACGAATGAGGAGTGGATGGCGGGTGTGCACTTTGTGAACTCC
ATCGGTGCTGTTTCTACGCCGGAGCGCAACGAGGCGCATCGTGTGTCGGATGTTTTGGGGCTGGAATCGTGAGTT
TACTCACCTTTTTGTTGCTGGAAGATGAGACGAGGCTGATTGTAGCAAACGACGACAAAGGCTGGTGGATGAAAT
CGCAAACAAGGTCGTCGCTCAGGACGGAGACGCCGACCCGACTTCTTCCTCCATCCTCGGCCCCTTTTGGTCTCC
CAACGCTCCCTTCCGTCCCAACGGTTCGTCCATCATCCAGGATCCGGCTCCGGGGGGGCGCACGTGCCGGATGCA
CGGCACCATCTCGGACCTCGCCACGGGGAAGCCTATCCCCGGAGCCGTCTTCGATCTCTGGCAGGCCAGCACCAA
CGGCTGCTACGACTTTCAGGATCCGGAGGGTCAGACGCCGAATAACCTGAGGGGCAAGTTCACGGCGGATGAGCA
GGGACGGTACAGCCTCATCTGTCTGCATCCTACGGCCTACTCGCTGCCGACGGACGGTCCGAGCTATCGATTGCT
GCGGCTGATGGATCGGCATCCCATGCGGCCAGCGCATATCCACATCCGGGTGAGTTTTCTTGTATTCTTTTGAAG
GGCATTCTGTTGACCGAGGTCTAGGTGACGCATCCGGATTATAGGGGCTGCACGACGCAGCTTTACCCGCGCCAT
GACCCGTATCTGGCGACGGATACCGTGTTTGCTGTCAAGGACGATCTGGTGGTTGACTTTGAGCCGCTGGTTGGA
GATGGTGAGGCCGAATTGGGGCTCGAATACAACGTGTTTCTGACGCCCAAGGGGTATAAGAGCCGTTATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail