Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01429
Gene name
Locationscaffold_01:4981987..4983861
Strand+
Gene length (bp)1874
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01595 CNNM Cyclin M transmembrane N-terminal domain 4.5E-33 51 219

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 44 66 22
3 127 149 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 72.47 41.44 103.50
Alive In ants, during behavior modification 55.45 31.29 79.60
Dead In ants, recently dead 82.47 46.71 118.22

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.160936 no
Alive Dead 0.011483 yes
Dead Fungus 0.540893 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01429
MRRHGTSAAFTNLRPVVLGLGRLMGVAAAPLVLPDDNHVRDTPIWVLALASMTLVLLGGAFAGLTIAFMGQDSIY
LQVLSGDPAEPQHRNAKSVLSLLKRGKHWVLVTLLLANVIVNESLPVVLDRTLGGGVAAVVGSTVLIVIFGEIVP
QSICVRFGLPIGGYMSKPVLLLMYLLSPVAWPTAKLLDWILGEDHGTVYKKSGLKTLVTLHKSLGDLSERLNQDE
VTIITAVLDLKDKPVSEVMTPMDDVFTLAEDHVLDEKTMDNILSSGYSRIPIYRAGNPTDFVGMLLVKTLITYDP
EDRIPVRDVQLGAIVETRPETSCLDIINFFQEGKSHMVLVSEYPGSDHGALGVVTLEDVIEELIGEEIVDESDVY
VDVHKAIRRLTPAPRARRHHHEDASSATSVTAVAVKKPADGSLLVDIAEHPEGSVLTVGSPGAVSDTGAMAEHHP
KTAIFMKRRSSAGPDGKAELGTVPIKASLDDMKRQLRLGPANRAARPRNTRNDVFKIKQGLGVTTAAAAAGTASN
GKLVSKAATVDEGEESPLLPTVNGGRPGSTRYGSAQGGGEE*
Coding >Ophcf2|01429
ATGAGAAGACATGGTACCTCTGCAGCCTTTACCAATTTGAGGCCGGTCGTCCTCGGCCTTGGACGGCTGATGGGC
GTCGCGGCCGCGCCTCTGGTCCTTCCCGACGACAATCATGTCCGCGACACTCCCATCTGGGTCCTGGCCCTCGCA
TCCATGACTCTCGTCCTTCTGGGCGGCGCATTCGCTGGCTTAACCATCGCCTTCATGGGCCAGGACAGCATCTAT
CTCCAGGTCCTTTCGGGCGACCCCGCAGAGCCGCAGCATAGGAATGCCAAGAGCGTCCTCAGTCTACTCAAAAGG
GGCAAGCACTGGGTCCTCGTCACCCTGCTTCTGGCCAACGTCATCGTCAACGAGTCGCTCCCCGTCGTCCTCGAC
CGCACCCTCGGAGGCGGCGTCGCTGCTGTCGTCGGCAGCACCGTCCTTATCGTCATCTTTGGCGAAATCGTTCCC
CAGTCCATATGCGTTCGCTTCGGCCTGCCCATCGGCGGCTACATGTCGAAGCCCGTCCTCCTGCTCATGTATCTG
CTAAGTCCCGTCGCCTGGCCCACCGCCAAGCTTCTCGACTGGATCCTGGGTGAGGATCACGGCACCGTGTACAAG
AAGAGCGGACTCAAGACGCTCGTCACGCTGCACAAGTCTCTTGGCGATCTATCGGAGCGACTGAACCAGGACGAG
GTCACCATCATCACCGCCGTTCTCGACTTGAAGGACAAGCCCGTGTCCGAGGTCATGACACCCATGGATGACGTC
TTCACCCTTGCCGAAGATCACGTCCTGGACGAAAAGACTATGGATAACATCCTATCGTCGGGCTACTCGAGGATT
CCCATCTACCGCGCGGGCAACCCAACCGACTTCGTCGGCATGCTACTGGTCAAGACGCTCATCACGTACGACCCA
GAGGACCGCATTCCAGTCAGAGACGTACAGCTGGGCGCCATCGTCGAAACGCGGCCAGAGACCAGCTGCCTCGAC
ATCATCAACTTTTTCCAGGAGGGAAAATCTCACATGGTGCTGGTGTCCGAATACCCAGGGTCCGACCACGGCGCG
CTGGGCGTCGTCACTCTTGAAGACGTCATTGAGGAGCTCATCGGAGAGGAAATCGTGGACGAATCGGACGTGTAC
GTGGATGTGCACAAGGCGATTCGACGCCTGACGCCGGCGCCGCGGGCCAGGCGGCATCATCACGAAGACGCGTCG
TCGGCGACCTCGGTCACGGCCGTAGCGGTTAAGAAGCCCGCTGACGGATCGCTTCTGGTGGATATTGCCGAGCAC
CCCGAGGGATCGGTCCTCACGGTCGGCTCGCCAGGAGCGGTCAGCGATACGGGCGCCATGGCGGAACACCACCCG
AAGACGGCCATCTTTATGAAGCGGCGCAGCTCTGCGGGACCCGACGGGAAAGCCGAGCTCGGGACGGTGCCGATC
AAGGCGTCGCTGGACGACATGAAGCGACAACTACGACTAGGGCCGGCTAACCGCGCGGCGCGGCCCCGTAACACA
CGGAACGATGTTTTCAAAATCAAACAGGGACTCGGAGTTACGACGGCGGCGGCGGCGGCTGGCACGGCGAGTAAC
GGAAAACTGGTGTCCAAGGCGGCGACTGTCGACGAGGGCGAGGAGTCGCCGCTGCTGCCGACGGTCAATGGCGGA
CGGCCTGGTTCGACGCGCTACGGATCAGCCCAGGGCGGAGGAGAGGAGTGA
Transcript >Ophcf2|01429
ATGAGAAGACATGGTACCTCTGCAGCCTTTACCAATTTGAGGCCGGTCGTCCTCGGCCTTGGACGGCTGATGGGC
GTCGCGGCCGCGCCTCTGGTCCTTCCCGACGACAATCATGTCCGCGACACTCCCATCTGGGTCCTGGCCCTCGCA
TCCATGACTCTCGTCCTTCTGGGCGGCGCATTCGCTGGCTTAACCATCGCCTTCATGGGCCAGGACAGCATCTAT
CTCCAGGTCCTTTCGGGCGACCCCGCAGAGCCGCAGCATAGGAATGCCAAGAGCGTCCTCAGTCTACTCAAAAGG
GGCAAGCACTGGGTCCTCGTCACCCTGCTTCTGGCCAACGTCATCGTCAACGAGTCGCTCCCCGTCGTCCTCGAC
CGCACCCTCGGAGGCGGCGTCGCTGCTGTCGTCGGCAGCACCGTCCTTATCGTCATCTTTGGCGAAATCGTTCCC
CAGTCCATATGCGTTCGCTTCGGCCTGCCCATCGGCGGCTACATGTCGAAGCCCGTCCTCCTGCTCATGTATCTG
CTAAGTCCCGTCGCCTGGCCCACCGCCAAGCTTCTCGACTGGATCCTGGGTGAGGATCACGGCACCGTGTACAAG
AAGAGCGGACTCAAGACGCTCGTCACGCTGCACAAGTCTCTTGGCGATCTATCGGAGCGACTGAACCAGGACGAG
GTCACCATCATCACCGCCGTTCTCGACTTGAAGGACAAGCCCGTGTCCGAGGTCATGACACCCATGGATGACGTC
TTCACCCTTGCCGAAGATCACGTCCTGGACGAAAAGACTATGGATAACATCCTATCGTCGGGCTACTCGAGGATT
CCCATCTACCGCGCGGGCAACCCAACCGACTTCGTCGGCATGCTACTGGTCAAGACGCTCATCACGTACGACCCA
GAGGACCGCATTCCAGTCAGAGACGTACAGCTGGGCGCCATCGTCGAAACGCGGCCAGAGACCAGCTGCCTCGAC
ATCATCAACTTTTTCCAGGAGGGAAAATCTCACATGGTGCTGGTGTCCGAATACCCAGGGTCCGACCACGGCGCG
CTGGGCGTCGTCACTCTTGAAGACGTCATTGAGGAGCTCATCGGAGAGGAAATCGTGGACGAATCGGACGTGTAC
GTGGATGTGCACAAGGCGATTCGACGCCTGACGCCGGCGCCGCGGGCCAGGCGGCATCATCACGAAGACGCGTCG
TCGGCGACCTCGGTCACGGCCGTAGCGGTTAAGAAGCCCGCTGACGGATCGCTTCTGGTGGATATTGCCGAGCAC
CCCGAGGGATCGGTCCTCACGGTCGGCTCGCCAGGAGCGGTCAGCGATACGGGCGCCATGGCGGAACACCACCCG
AAGACGGCCATCTTTATGAAGCGGCGCAGCTCTGCGGGACCCGACGGGAAAGCCGAGCTCGGGACGGTGCCGATC
AAGGCGTCGCTGGACGACATGAAGCGACAACTACGACTAGGGCCGGCTAACCGCGCGGCGCGGCCCCGTAACACA
CGGAACGATGTTTTCAAAATCAAACAGGGACTCGGAGTTACGACGGCGGCGGCGGCGGCTGGCACGGCGAGTAAC
GGAAAACTGGTGTCCAAGGCGGCGACTGTCGACGAGGGCGAGGAGTCGCCGCTGCTGCCGACGGTCAATGGCGGA
CGGCCTGGTTCGACGCGCTACGGATCAGCCCAGGGCGGAGGAGAGGAGTGA
Gene >Ophcf2|01429
ATGAGAAGACATGGTACCTCTGCAGCCTTTACCAATTTGAGGCCGGTCGTCCTCGGCCTTGGACGGCTGATGGGC
GTCGCGGCCGCGCCTCTGGTCCTTCCCGACGACAATCATGTCCGCGACACTCCCATCTGGGTCCTGGCCCTCGCA
TCCATGACTCTCGTCCTTCTGGGCGGCGCATTCGCTGGCTTAACCATCGCGTTAGCTCCATGACGCTCCCCAACT
GTGAACCGCGACGAGGCTGACGCGCAGCAGCTTCATGGGCCAGGACAGCATCTATCTCCAGGTCCTTTCGGGCGA
CCCCGCAGAGCCGCAGCATAGGAATGCCAAGAGCGTCCTCAGTCTACTCAAAAGGGGCAAGCACTGGGTCCTCGT
CACCCTGCTTCTGGCCAACGTCATCGTCAACGAGTCGCTCCCCGTCGTCCTCGACCGCACCCTCGGAGGCGGCGT
CGCTGCTGTCGTCGGCAGCACCGTCCTTATCGGTACGTAAATCTCTTCCCAACTTACCCAGGTATGCTCCTGGTG
CTGACCATCCAAACTGCAGTCATCTTTGGCGAAATCGTTCCCCAGTCCATATGCGTTCGCTTCGGCCTGCCCATC
GGCGGCTACATGTCGAAGCCCGTCCTCCTGCTCATGTATCTGCTAAGTCCCGTCGCCTGGCCCACCGCCAAGCTT
CTCGACTGGATCCTGGGTGAGGATCACGGCACCGTGTACAAGAAGAGCGGACTCAAGACGCTCGTCACGCTGCAC
AAGTCTCTTGGCGATCTATCGGAGCGACTGAACCAGGACGAGGTCACCATCATCACCGCCGTTCTCGACTTGAAG
GACAAGCCCGTGTCCGAGGTCATGACACCCATGGATGACGTCTTCACCCTTGCCGAAGATCACGTCCTGGACGAA
AAGACTATGGATAACATCCTATCGTCGGGCTACTCGAGGATTCCCATCTACCGCGCGGGCAACCCAACCGACTTC
GTCGGCATGCTACTGGTCAAGACGCTCATCACGTACGACCCAGAGGACCGCATTCCAGTCAGAGACGTACAGCTG
GGCGCCATCGTCGAAACGCGGCCAGAGACCAGCTGCCTCGACATCATCAACTTTTTCCAGGAGGGAAAATCTCAC
ATGGTGCTGGTGTCCGAATACCCAGGGTCCGACCACGGCGCGCTGGGCGTCGTCACTCTTGAAGACGTCATTGAG
GAGCTCATCGGAGAGTAAGTGTGACTGGAGAAGAGGAACGACCGGACGAGTCGTACTGATGTCATAGCAGGGAAA
TCGTGGACGAATCGGACGTGTACGTGGATGTGCACAAGGCGATTCGACGCCTGACGCCGGCGCCGCGGGCCAGGC
GGCATCATCACGAAGACGCGTCGTCGGCGACCTCGGTCACGGCCGTAGCGGTTAAGAAGCCCGCTGACGGATCGC
TTCTGGTGGATATTGCCGAGCACCCCGAGGGATCGGTCCTCACGGTCGGCTCGCCAGGAGCGGTCAGCGATACGG
GCGCCATGGCGGAACACCACCCGAAGACGGCCATCTTTATGAAGCGGCGCAGCTCTGCGGGACCCGACGGGAAAG
CCGAGCTCGGGACGGTGCCGATCAAGGCGTCGCTGGACGACATGAAGCGACAACTACGACTAGGGCCGGCTAACC
GCGCGGCGCGGCCCCGTAACACACGGAACGATGTTTTCAAAATCAAACAGGGACTCGGAGTTACGACGGCGGCGG
CGGCGGCTGGCACGGCGAGTAACGGAAAACTGGTGTCCAAGGCGGCGACTGTCGACGAGGGCGAGGAGTCGCCGC
TGCTGCCGACGGTCAATGGCGGACGGCCTGGTTCGACGCGCTACGGATCAGCCCAGGGCGGAGGAGAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail