Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01419
Gene name
Locationscaffold_01:4949986..4961978
Strand-
Gene length (bp)11992
Transcript length (bp)11865
Coding sequence length (bp)11865
Protein length (aa) 3955

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 4.1E-80 2999 3410
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 7.7E-72 9 256
PF00668 Condensation Condensation domain 1.7E-63 2546 2973
PF08659 KR KR domain 4.9E-58 2111 2285
PF14765 PS-DH Polyketide synthase dehydratase 3.3E-58 941 1236
PF00698 Acyl_transf_1 Acyl transferase domain 5.3E-47 551 853
PF07993 NAD_binding_4 Male sterility protein 5.6E-38 3647 3870
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.0E-30 264 388
PF08242 Methyltransf_12 Methyltransferase domain 2.5E-18 1417 1517
PF00550 PP-binding Phosphopantetheine attachment site 7.1E-05 2401 2461
PF00550 PP-binding Phosphopantetheine attachment site 2.1E-10 3533 3596
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 4.5E-15 398 506
PF01370 Epimerase NAD dependent epimerase/dehydratase family 2.3E-12 3645 3842
PF00106 adh_short short chain dehydrogenase 4.3E-12 2110 2285
PF13489 Methyltransf_23 Methyltransferase domain 4.7E-13 1404 1569
PF13649 Methyltransf_25 Methyltransferase domain 6.0E-11 1416 1515
PF13847 Methyltransf_31 Methyltransferase domain 1.4E-09 1413 1523
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.2E-05 3646 3750
PF08241 Methyltransf_11 Methyltransferase domain 3.9E-08 1417 1518

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0003824 catalytic activity Yes
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0071704 organic substance metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0016229 steroid dehydrogenase activity No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0008202 steroid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901360 organic cyclic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0008610 lipid biosynthetic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5776 0.3605 0.1164 0.0299 0.1703 0.0319 0.0558 0.1288 0.0715 0.0073

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 6 PKS-NRPS hybrid

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 15.91 8.71 23.11
Alive In ants, during behavior modification 9.03 5.12 12.94
Dead In ants, recently dead 10.04 5.67 14.41

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.001768 yes
Alive Dead 0.574859 no
Dead Fungus 0.014528 yes

Orthologs

Orthofinder run ID4
Orthogroup11
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1456
Ophiocordyceps camponoti-floridani Ophcf2|04509
Ophiocordyceps camponoti-floridani Ophcf2|05945
Ophiocordyceps camponoti-floridani Ophcf2|05210
Ophiocordyceps camponoti-floridani Ophcf2|04876
Ophiocordyceps camponoti-floridani Ophcf2|03559
Ophiocordyceps camponoti-floridani Ophcf2|02946
Ophiocordyceps camponoti-floridani Ophcf2|02940
Ophiocordyceps camponoti-floridani Ophcf2|02393
Ophiocordyceps camponoti-floridani Ophcf2|02162
Ophiocordyceps camponoti-floridani Ophcf2|01419 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00877
Ophiocordyceps camponoti-floridani Ophcf2|00026
Ophiocordyceps camponoti-floridani Ophcf2|02640
Ophiocordyceps camponoti-rufipedis Ophun1|7018
Ophiocordyceps camponoti-rufipedis Ophun1|5875
Ophiocordyceps camponoti-rufipedis Ophun1|61
Ophiocordyceps camponoti-rufipedis Ophun1|7079
Ophiocordyceps camponoti-rufipedis Ophun1|2808
Ophiocordyceps camponoti-rufipedis Ophun1|7149
Ophiocordyceps camponoti-rufipedis Ophun1|7480
Ophiocordyceps camponoti-rufipedis Ophun1|5641
Ophiocordyceps camponoti-rufipedis Ophun1|7148
Ophiocordyceps camponoti-rufipedis Ophun1|5297
Ophiocordyceps camponoti-rufipedis Ophun1|839
Ophiocordyceps camponoti-rufipedis Ophun1|5181
Ophiocordyceps camponoti-rufipedis Ophun1|5180
Ophiocordyceps camponoti-rufipedis Ophun1|5123
Ophiocordyceps camponoti-rufipedis Ophun1|5085
Ophiocordyceps camponoti-rufipedis Ophun1|4013
Ophiocordyceps camponoti-rufipedis Ophun1|2837
Ophiocordyceps camponoti-rufipedis Ophun1|7483
Ophiocordyceps camponoti-rufipedis Ophun1|1461
Ophiocordyceps camponoti-rufipedis Ophun1|5183
Ophiocordyceps kimflemingae Ophio5|2713
Ophiocordyceps subramaniannii Hirsu2|2752

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01419
MSLQKPIEEPIAVVGVACRFPGGANSPSKLWDLLCEKRDVQQTISRFNVDGFYDDNGEKSGCTNAKKAYLLSEDI
RLFDAAFFRTSPHEAESMDPQQRILLETVYEATEDAGIPLKPDGSNVAVYVGNMTGDYHEMLLRDPQHLPKYMAT
GTARSILSNRVSYFFNWKGPSVTIDTACSSSLVAVHEAVTTLRLGVSDVACAAGTNLILGPEMMISESKLHMLSP
TGRSNMWSASADGYARGEGVAAVILKTLSRALKDGDHIHALIRATGVNSDGRTSGITLPSSESQKELIRRTYANA
GLDYSSDAGRCQFFEAHGTGTPAGDPIEARAIHEAFFDDSKGNPEAMILVGSIKTAIGHLEGCAGLAGLIKAVEA
VRRGVVPPNLHFDKLNPAIVPYSNHLKIVTDVLPWPELPPNTPRRVSVNSFGFGGTNAHAIVENFQDNTTDKRLL
GERIVTPLVVSANSEHSLRGLVDALRERLGAMDDDEELGRILFTLAERRTQLPLRATFSAHSVQALRKRLEEATT
SASDAEPMAFLQDVRQPGQRGRIMGVFTGQGAQWPTMGRELLRESAFARSLMTKLEESLAALPEPPAWRLTEQCI
ADADASRLGEAAVSQPLCTAIQLIVVELLRRAGVRFSCVVGHSSGEIAAAYAAGFISVEDAIRIAYCRGVCAGLA
RGSDGQRGAMMAAGLPYDEAVNLCSERFPGRLSVAASNSPSGVTLSGDQDAVDEAVALLQQRGIFTRILKVDTAY
HSSHMVPCAGPYLSLLEACKIRPMAGDPSCEWYSSVIGQRMDGSRHADLLSAEYWKENMIKPVFFTQAIELAAKM
SVPPCHVALEVGPHPALKGPFGQTIKQTLGAQLPYQATLVRGVDDVEALSNTLGFLWSCLGSDAVDMVSYAEAFS
SAIITRSLATDIPSYQWDHTQSFWREPAKSVRYRLRKHPPHPLLGVRSTEDSAHEFRWLNTLRLSDLPWLEGHKV
EQQVIYPAAGYLVMAMEAAKALDESTHVRHVELYDVSISSAVHLSYDSAGVDTLFTLRLRERQAELRIAQWACYS
SPATVDNGWKCNASGWLRVEFGSPPAAKSALLPPRNIAACSLNAVDMERFYTCLRGIGLDYTGEFKHLHGVRRRS
GMATAKAMYKAPRFPAMIHPALLDSAFQTLFAAYCWPDDGSLQVPFVPTSLRSLKLINMNELPGGEQLDIDAYLT
NSRDRDLAADIDVFTASSGRPLMQLQGLTCTSLRKLGPRDYKELYTQTVWELDIDSGVASLENARSDNPEDLELV
DLCERLAYFYLRDLRRQVAPEEVAVMDWNFKRIFEWIDEELFPAIEAGRHPTIRKEWLADNRSWLMDQATKFGPQ
VDLLLLQAVGDNLAAVVRKETTMLEHMIKDDVLNRFYKSGLGFQKANGYLSRIAKQIAHCRPRMNILEIGAGTGG
ATKGILESLGTTFESYTFTDISPGFFEAAADAFAPWASKMTFKTLDIEKDSASQDFSAGYDLIIASNVLHATESL
SNTLRNVRRLLKPEGRLLLLEVTSDIVRVKFMMSGLPGWWLGGNDGRRYGPTISVSRWHSELLSAGFSGVDHALR
DFSDHRYMNSVMVSQAVDETSRVLCQPLSNSGGWLSGHTVTIIGGECSGIARNISKTLHLAAKSPSDVVVKVVER
FEQMPSDLPPMRTVLVLEDLDDPLFRAMTSEKLAALQRTMNEARQVLWVSRGCRKEEAYASMSIGLCRSLAAEFP
HVQIQHIDIEESDVSMPVVSYRVSEALARLIFKSTLKQPPPTESELTLENGKWLIPRILPDGPLNDQLNASKMMV
KTQSSLAHETIDIYRSKGEFIVAKPTPSLLDVQSAGTGDISIHVALMAVTPLRVDDDTPAFLSYGFKAGDACSPV
LAVSSTCSSRIYVPEHCVLDCSGLDVSDPPKLLRKALVAVAATQVLAGVPPGATVIQHEADQSLGAAVQWKAAEM
GVKCVSTTFTASEQQDCGKSGPIRIHPKTPERDLKKLFPGDTTLLIDYSSAGKAADLEESSLRRCLPTRSKFTAS
QDIFGDDDMTAKQPSIVASKQIKDTLQSGLDFEVSDVERIITVSDLPGRAILDTPYTTIVDFASASPVATTLRPL
DGSLLFRPDKTYLMVGCTGGLGQSLCRWMVSNGVRNLALTTRNMARLDSGWLEELRFQGATVRLFEVDVSDKDAL
AAVHAQIVRKMPPICGVAHAAMVLSDRSFGELTSDDFEAVLGPKVRGTQHLHDIFLDQQLDFFILFSSLASIVGN
RGQSNYSAANLFMTAVAEQRRARGLAASVMHIGMVLGVGYVSSNGTHEATLRQYNYMPISEPEFLNMFAQAILVG
QPTSGHSPEIISGLNRYSLQPDGQRFFWSENQRFCHHVLEEQSQEICTGENMTFSQRLVEAQSPEEMLSVVQEGF
CSKLERMLQAEAGTIRISQALINLGVDSLIAAEIRSWFLKELEVDMPVLSILNTTSIADLCLEAVCRVSETPGSR
DAQANKMTVLTEKSPDPGYDGSVAAGSSTEASPIDVSSESNGFGSSASSVGGDTDCSAFATERPKLERTGRLSFA
QERVWFMQQLLHGQTAYNVTLMYRIKGPLRLSELERAFHAVIRRHEALRSCFFVDPETALPAQGVCHNSIFALEE
KTHVSSTAEEEFKRIQESLYDLEHGPILRAVIHRSAGHNEHTLVLGFPHIALDGFSAQILMRDLALAYSGQELPR
MPNSYLDYAAEERVAQIPVEKLGYWKSEFETLPAVLPLFDFAECRARVPLTEYRTRTMERTLPSSISDSIKTEAR
ELGATPFHVYLAALQTLLFEMTSTSDICIGVVDANKTAAAYMDTIGFFVNLLPLRFQRHASQTMSDLVKEAKTKA
DEALAHGVPFDVLLEELKLPRSSTYSPLIQVMLNFKMGSTRSAPIGDCQAELLGFKDADNPYDLVFDVESFQDGS
TWISIKTQQYLYTDHELELVMKTFVRILTSFSEKPWRDTTNITEPGPDERRKTLELGRGARIPPPKFSTISDCFR
NRAASQPDAMAVTDDGGASLSYANLNSMVASIAAALKQTGLRLGARICVYCEPSVRIIACFLAIAQVGGAYVPLD
SQAPAQRLQLILDDCEPDVIIFDKTSSVASLRTEARLLDIEDIQETSVSPADGESQAQESGTAFIVYTSGTSGIP
KGVKITHRNLIQHSDAVVEFYGLRRGIMLQQAPLGFDLSLSQMTLSIVTGGTLLVASNATRRDPARLARLMRSGR
VTQTIMTPTQALALVHHGRGELMQCTDWVFSLLSGERLRRHVVSEFRRLGMSALKLHNGYGPTEISINCSGGVDE
LSVTAPCDTVDPTIGVTLPNYTCYILDDELRPVGTGLAGELFVGGCGVAAGYLGRPELTESRFLADPFASASDLA
QGWSWMYRTGDKAKLLPDGRIVFLGRITGDSQIKLRGFRIELQDVATNIVKASNGAISDAAVSLRKGPVADQDDG
FLVAFVVLSDTACSEEEPEEYLRRLLRDLTLSLPQYMIPSVMGPVDELPVNSSGKLDRHALDALPLPRTVEPDES
EPLTTTQERLKAVWLEALPMETHIGRETDFFEAGGNSLRLVALREHVARRFGVSLSVLELFQWSTLAGMASKIDS
STESPERRGPIDWSAETRVETTSLDWPTVSRQVRPAFDVAEGLEVVLTGATGFLGSAILKQLLQDRRVKHVHCLA
VRDDAKAAEQQASLASDRVTYYDGDLALPRLGLSQQVFEELSRKAHRIIHNGADVSLLKSYRSLQKANVESTREM
ALLAAPRQVPLHFVSSGGIASLAGVEALPQMSLSDVRPPVDGSQGYAASKWASEVFLEGYTREVGTPTWIHRPAN
ITGADAPSTDLMQNLIAYSSKTGALPDVGSWRGSVDLVPVEVVSEGIVRTIHEGGSSGNTVFLHHCAAKKIAVDE
LAAWLGVETVELDEWLERASGAGLDETASLLIRGMLERGAGGVVPCLLGAERAL*
Coding >Ophcf2|01419
ATGAGTCTCCAGAAGCCCATCGAGGAGCCCATCGCCGTAGTCGGTGTGGCATGCCGCTTTCCAGGCGGTGCAAAC
AGTCCGTCCAAGCTCTGGGATCTCCTCTGCGAGAAACGAGATGTTCAACAGACAATCTCGCGTTTCAACGTCGAC
GGCTTTTATGACGACAACGGTGAAAAGTCGGGATGCACAAACGCAAAGAAAGCATACCTCCTGTCTGAAGACATA
CGCCTGTTTGATGCCGCCTTCTTTCGAACCAGCCCACACGAGGCGGAAAGCATGGATCCCCAGCAAAGAATCCTA
TTAGAGACAGTATACGAAGCGACCGAGGATGCTGGAATCCCGCTCAAGCCAGACGGATCCAACGTTGCCGTCTAC
GTCGGTAACATGACGGGCGACTATCATGAGATGCTGCTGCGCGATCCCCAGCATCTGCCCAAGTATATGGCGACA
GGCACCGCTAGAAGCATACTCTCGAATCGCGTGTCGTACTTCTTCAACTGGAAAGGACCGTCCGTGACCATCGAT
ACGGCCTGTTCTTCTAGCCTCGTCGCAGTGCACGAGGCGGTCACCACGCTGCGGCTGGGTGTCTCGGACGTTGCC
TGTGCGGCCGGAACGAATCTGATTCTCGGCCCGGAGATGATGATATCCGAGTCTAAGCTGCACATGCTGTCACCC
ACAGGCCGTAGTAACATGTGGTCCGCGTCCGCCGACGGATACGCCCGGGGCGAGGGCGTGGCGGCCGTCATTCTC
AAAACGCTCTCCCGGGCACTGAAAGATGGAGATCACATCCACGCACTCATTCGTGCAACTGGCGTCAACTCTGAC
GGACGTACCAGTGGCATCACGCTGCCCAGCTCTGAGTCCCAGAAGGAGCTGATTAGGAGGACGTACGCGAATGCT
GGCCTCGATTATTCTTCTGACGCGGGACGGTGCCAGTTCTTCGAAGCTCATGGAACAGGCACGCCTGCCGGGGAC
CCCATTGAAGCAAGGGCCATTCACGAGGCATTTTTCGATGATAGCAAAGGAAACCCAGAAGCGATGATTCTCGTC
GGATCGATCAAGACAGCCATTGGACACTTGGAAGGCTGTGCTGGTCTGGCAGGCCTCATCAAGGCCGTCGAAGCC
GTCCGCCGCGGCGTGGTGCCTCCGAACTTGCACTTTGATAAGCTCAATCCAGCCATCGTGCCCTATTCAAACCAC
CTGAAGATCGTCACGGACGTCTTGCCATGGCCGGAGCTGCCGCCGAACACGCCGCGTCGAGTCAGTGTTAACTCG
TTCGGCTTCGGCGGTACTAACGCGCACGCCATCGTGGAAAACTTCCAAGACAACACAACGGATAAAAGGCTCCTC
GGCGAACGTATCGTCACACCACTGGTCGTGTCTGCTAACTCGGAACACTCGCTCCGTGGACTTGTTGATGCGCTG
CGTGAGAGGCTCGGGGCCATGGATGACGACGAGGAGCTGGGCCGCATTCTCTTCACGCTCGCAGAAAGAAGGACG
CAGCTCCCGCTTCGGGCCACGTTCTCCGCACATTCGGTACAAGCCCTGCGGAAGAGACTGGAGGAAGCGACGACA
TCAGCCAGCGACGCGGAACCCATGGCCTTTCTCCAGGATGTCAGACAACCAGGCCAACGAGGGAGAATCATGGGC
GTCTTCACAGGCCAGGGAGCCCAGTGGCCGACGATGGGCCGCGAGTTGCTGCGGGAATCGGCTTTTGCTCGGAGT
CTCATGACGAAGCTGGAAGAGAGTCTTGCAGCCCTGCCGGAGCCGCCGGCTTGGAGATTGACGGAACAATGTATC
GCCGACGCCGACGCCTCCCGACTCGGTGAGGCGGCCGTCTCTCAGCCGCTGTGCACGGCCATCCAGCTCATCGTC
GTCGAGCTTCTGCGCCGCGCTGGAGTGCGCTTCAGCTGTGTTGTCGGCCATTCTTCGGGGGAGATAGCTGCTGCT
TATGCCGCTGGATTCATTTCGGTCGAGGATGCCATCCGTATCGCTTACTGTCGCGGTGTCTGTGCCGGCCTCGCC
CGGGGCTCGGACGGCCAGAGGGGGGCCATGATGGCTGCCGGTCTCCCCTACGATGAGGCTGTGAATCTTTGCAGT
GAACGATTTCCTGGACGTCTCTCTGTTGCGGCTAGTAACTCCCCGTCTGGAGTCACTTTGTCTGGGGATCAGGAC
GCTGTCGATGAGGCCGTGGCACTTCTTCAACAACGAGGGATCTTCACTCGCATCCTCAAAGTTGATACAGCATAT
CATTCATCACACATGGTTCCGTGTGCCGGCCCGTACTTATCTCTCCTCGAAGCGTGCAAAATTCGGCCGATGGCA
GGGGACCCGTCTTGCGAATGGTACTCAAGCGTCATCGGTCAACGCATGGACGGCTCCAGACATGCGGACCTCCTC
TCGGCCGAGTACTGGAAGGAGAACATGATTAAGCCAGTCTTCTTCACTCAAGCCATTGAACTAGCTGCCAAAATG
TCGGTTCCGCCTTGTCATGTCGCTCTCGAGGTTGGCCCGCACCCGGCGCTCAAGGGTCCCTTCGGACAGACGATC
AAACAAACACTGGGTGCTCAGCTGCCCTATCAGGCCACCCTTGTCCGAGGAGTTGATGATGTCGAAGCTCTGAGC
AACACTCTTGGGTTCCTGTGGTCCTGTCTCGGCAGTGATGCCGTCGACATGGTTTCTTATGCCGAGGCCTTTTCT
TCCGCCATCATCACTCGTTCTTTGGCAACAGACATACCCTCTTATCAATGGGATCACACACAGTCGTTTTGGAGA
GAACCCGCCAAATCGGTGAGGTACCGGCTTCGGAAGCACCCCCCACACCCGCTCCTCGGCGTTCGTTCGACTGAG
GATTCAGCTCATGAGTTTCGCTGGCTCAACACCCTGAGACTTTCCGACCTGCCCTGGCTGGAGGGTCATAAAGTC
GAGCAGCAAGTCATATACCCTGCAGCCGGTTATCTGGTGATGGCCATGGAAGCGGCCAAGGCATTGGACGAGAGC
ACACATGTCCGCCATGTTGAGCTATACGACGTCTCCATCTCTAGTGCTGTGCATTTGAGCTACGACTCTGCGGGC
GTGGACACCCTGTTCACATTGCGGCTCCGCGAGAGACAAGCGGAATTGAGAATCGCTCAATGGGCGTGCTACAGC
TCGCCTGCAACCGTCGACAATGGCTGGAAATGCAACGCCAGCGGCTGGCTCCGCGTGGAATTCGGCTCGCCGCCG
GCCGCCAAGAGCGCTCTGCTTCCTCCGAGAAATATCGCAGCTTGCAGCTTGAATGCTGTGGACATGGAACGCTTC
TACACATGTCTCCGCGGTATTGGTCTCGACTACACTGGCGAGTTCAAGCATCTTCATGGCGTACGAAGGAGATCG
GGAATGGCAACGGCAAAGGCGATGTATAAAGCTCCTCGCTTCCCGGCAATGATTCACCCGGCTCTACTGGACTCG
GCTTTCCAGACCCTTTTTGCTGCTTACTGCTGGCCCGACGATGGTAGTCTTCAGGTTCCCTTCGTGCCCACGTCT
CTCCGGAGTCTGAAGTTGATCAACATGAACGAATTACCTGGAGGGGAGCAGTTGGACATTGACGCTTACCTGACC
AACTCGAGGGACCGCGACCTGGCCGCTGATATTGACGTGTTCACAGCTTCGAGCGGCCGGCCGCTGATGCAGCTT
CAGGGCCTGACCTGCACATCTCTCCGCAAATTGGGTCCCCGAGACTACAAGGAGCTCTATACACAGACTGTTTGG
GAGCTTGACATCGACAGTGGTGTTGCATCTTTGGAGAATGCCAGAAGCGACAACCCCGAGGACCTCGAGTTGGTG
GATCTGTGTGAACGCCTCGCCTACTTCTATCTCAGGGATCTTCGCCGCCAAGTCGCTCCCGAGGAAGTGGCAGTA
ATGGATTGGAATTTCAAGCGCATCTTTGAGTGGATTGACGAGGAGCTGTTTCCGGCCATCGAAGCAGGGAGACAT
CCCACCATTCGGAAAGAGTGGCTTGCAGACAACCGATCGTGGCTGATGGACCAAGCGACGAAATTTGGACCCCAG
GTCGATCTTCTGCTTCTCCAGGCAGTAGGCGACAATCTCGCTGCCGTCGTTCGCAAGGAAACCACCATGCTGGAG
CACATGATCAAGGACGACGTTCTCAATCGGTTCTACAAGTCCGGACTGGGCTTTCAGAAGGCCAATGGCTACTTG
TCTCGTATCGCGAAGCAGATTGCTCACTGCCGACCGAGGATGAACATTCTGGAAATAGGTGCTGGAACTGGCGGC
GCCACGAAAGGCATCCTCGAATCACTCGGCACCACGTTTGAGAGTTACACCTTCACAGACATCTCTCCCGGCTTT
TTCGAGGCAGCCGCCGATGCCTTCGCCCCCTGGGCTTCTAAGATGACATTCAAAACTCTGGACATTGAGAAGGAC
TCGGCATCGCAAGATTTCAGTGCCGGGTACGATTTGATCATAGCTTCCAACGTCCTGCACGCTACAGAATCGCTC
TCCAACACTCTGCGCAACGTACGTCGCCTGCTCAAACCCGAGGGCCGCCTCCTGTTGCTCGAGGTCACAAGCGAC
ATCGTCCGCGTCAAGTTTATGATGTCGGGCCTTCCAGGCTGGTGGCTTGGCGGAAACGATGGCCGACGCTACGGA
CCGACCATCAGCGTCTCGCGCTGGCACTCGGAGCTCTTGTCCGCCGGATTCTCCGGAGTCGACCATGCTTTGAGA
GATTTCTCGGATCACAGGTATATGAACTCTGTCATGGTTTCCCAAGCCGTCGATGAGACCTCCCGTGTGCTTTGC
CAGCCGCTATCGAATAGTGGCGGCTGGCTGTCAGGTCATACCGTGACTATCATTGGTGGCGAGTGCAGTGGTATT
GCAAGGAACATCTCGAAAACTTTGCATCTTGCTGCGAAATCACCGTCCGATGTTGTCGTCAAAGTCGTCGAGAGA
TTCGAGCAGATGCCGTCCGATTTGCCCCCGATGAGGACAGTGCTCGTCCTGGAGGATCTCGATGACCCCCTATTT
CGAGCTATGACGTCTGAAAAGCTCGCGGCGCTGCAGCGAACCATGAATGAAGCCCGACAGGTGCTCTGGGTATCG
AGAGGATGTCGCAAGGAGGAAGCGTACGCCAGCATGTCGATCGGGTTGTGCCGAAGTTTAGCGGCAGAATTCCCT
CACGTTCAGATTCAGCACATTGACATCGAAGAGTCCGACGTGTCTATGCCCGTCGTTTCCTACCGAGTTTCGGAG
GCCCTGGCGAGGCTGATCTTCAAGTCCACTTTAAAGCAGCCGCCGCCAACGGAATCGGAGCTGACGTTGGAAAAT
GGGAAATGGCTCATCCCGCGCATTCTGCCCGACGGGCCGTTGAACGATCAGCTCAACGCCAGCAAGATGATGGTG
AAGACTCAGAGCTCTCTGGCTCATGAGACAATTGACATTTATCGATCAAAAGGCGAATTCATCGTCGCTAAGCCA
ACTCCGTCCCTTCTAGATGTTCAGAGCGCTGGGACCGGCGATATCTCGATCCATGTGGCACTGATGGCTGTCACC
CCCTTACGCGTCGATGACGATACGCCTGCCTTCCTGTCGTACGGTTTCAAGGCTGGCGACGCCTGTTCTCCAGTC
CTTGCAGTGTCTTCGACTTGCAGCTCCCGCATCTACGTGCCCGAGCACTGCGTTCTCGACTGCTCAGGCTTGGAT
GTGTCCGATCCTCCGAAGCTTCTCCGCAAGGCTCTCGTCGCTGTGGCTGCGACTCAAGTTCTTGCTGGGGTACCT
CCCGGCGCAACGGTTATACAGCACGAGGCGGACCAGTCTTTGGGCGCGGCCGTTCAATGGAAGGCAGCCGAGATG
GGAGTGAAGTGCGTCTCTACCACCTTTACAGCTTCTGAGCAGCAAGATTGCGGGAAGTCCGGACCGATCCGAATC
CATCCTAAGACTCCCGAGCGCGACTTGAAGAAGCTGTTTCCTGGCGATACCACTCTTCTCATCGACTACTCAAGT
GCCGGCAAGGCGGCTGATCTTGAGGAGTCGTCCCTGCGTCGCTGTCTGCCAACTCGCTCCAAGTTTACAGCGTCG
CAAGACATCTTTGGAGATGATGACATGACTGCGAAACAACCTAGCATCGTGGCTTCTAAACAGATCAAGGACACT
CTGCAATCAGGTCTCGATTTTGAAGTATCGGATGTTGAACGGATCATTACTGTCTCGGATCTCCCTGGCCGGGCG
ATTCTCGATACTCCTTACACGACAATTGTTGATTTTGCGTCTGCGTCACCAGTTGCAACCACTCTTCGACCACTA
GATGGCAGCCTTCTCTTCCGCCCGGACAAAACCTACCTGATGGTAGGCTGCACAGGGGGGCTTGGTCAATCGCTA
TGTCGCTGGATGGTTTCCAACGGAGTCAGAAACTTGGCTCTTACGACGAGAAACATGGCACGACTTGATTCGGGG
TGGCTCGAAGAGTTGCGATTTCAAGGTGCGACTGTACGACTCTTCGAGGTTGATGTGAGCGACAAGGATGCCCTT
GCGGCGGTACACGCCCAGATCGTGCGAAAAATGCCCCCAATATGCGGTGTTGCTCATGCCGCGATGGTGCTATCT
GATCGTTCTTTCGGCGAACTCACAAGCGACGACTTTGAGGCGGTGCTTGGGCCCAAGGTCCGAGGCACGCAGCAT
TTACACGACATCTTTCTCGACCAGCAACTTGACTTCTTCATCCTCTTCTCGTCTCTGGCAAGCATTGTGGGCAAT
CGTGGACAGTCAAACTACTCTGCGGCCAATCTGTTCATGACTGCTGTGGCCGAACAGCGCAGAGCTCGAGGCCTG
GCAGCCTCGGTGATGCACATCGGGATGGTTCTTGGTGTCGGATATGTATCCTCCAATGGCACGCACGAAGCAACT
CTCAGGCAGTACAACTACATGCCCATCTCGGAGCCCGAGTTTCTCAACATGTTTGCGCAGGCCATTCTCGTTGGT
CAGCCCACGTCGGGACACTCCCCGGAGATCATCTCGGGTCTGAATCGATACAGCCTACAGCCTGATGGACAACGC
TTCTTCTGGTCTGAGAACCAAAGATTTTGCCACCATGTCCTAGAGGAACAAAGCCAAGAAATCTGCACCGGCGAG
AACATGACTTTTTCGCAGCGTCTCGTCGAGGCGCAGTCCCCGGAGGAGATGCTGTCTGTCGTTCAGGAAGGGTTC
TGCTCAAAACTCGAACGCATGCTCCAAGCTGAGGCTGGCACGATTCGAATTTCGCAAGCCTTGATCAACCTGGGA
GTCGACTCGCTGATCGCTGCCGAGATACGATCTTGGTTCTTGAAGGAACTCGAGGTGGACATGCCTGTGCTGAGC
ATTCTGAACACGACTTCTATTGCGGATCTTTGCCTCGAAGCCGTGTGTCGGGTTTCAGAGACTCCCGGATCGAGA
GATGCTCAAGCAAACAAGATGACTGTTTTGACCGAGAAATCGCCAGATCCTGGCTACGATGGATCAGTCGCGGCG
GGATCCTCTACCGAGGCCTCACCCATCGATGTCTCGTCGGAAAGCAATGGCTTCGGCTCAAGCGCCTCGAGCGTC
GGCGGCGACACGGATTGTTCGGCCTTTGCCACTGAGCGTCCAAAGCTCGAGCGGACCGGTCGCCTATCTTTTGCT
CAAGAACGTGTTTGGTTCATGCAGCAGCTTCTTCACGGTCAGACGGCCTACAACGTCACTCTCATGTACCGCATA
AAAGGGCCTCTTCGACTATCTGAGCTCGAGAGAGCCTTTCACGCCGTCATCCGCCGTCATGAGGCTCTGCGCAGC
TGCTTTTTTGTCGATCCAGAAACAGCTTTACCGGCTCAGGGAGTCTGTCACAATAGCATCTTTGCCCTGGAAGAG
AAAACTCATGTCTCGTCAACCGCTGAGGAAGAATTCAAGCGCATTCAAGAATCGCTTTACGACCTCGAGCATGGA
CCGATTCTTCGGGCTGTAATTCACCGCTCAGCTGGCCATAATGAGCACACCCTGGTCCTCGGGTTCCCGCACATT
GCCCTTGACGGCTTCAGTGCGCAGATACTGATGCGGGACTTGGCTTTGGCGTACTCGGGCCAAGAGCTTCCTCGA
ATGCCAAACAGCTATCTGGATTACGCAGCTGAGGAGCGTGTTGCGCAGATTCCCGTCGAGAAACTTGGGTATTGG
AAGTCTGAGTTTGAGACTCTGCCGGCTGTTTTACCGTTGTTCGACTTTGCAGAATGCAGGGCTCGCGTGCCCCTG
ACGGAGTATCGGACGAGGACCATGGAACGGACGCTACCGTCTAGCATTTCGGACAGCATCAAGACTGAGGCGCGA
GAGCTCGGGGCGACGCCGTTTCACGTGTACCTGGCAGCTCTGCAGACGCTTCTCTTCGAGATGACATCGACTTCA
GATATTTGCATCGGTGTCGTTGACGCGAACAAGACGGCTGCCGCTTACATGGACACGATTGGCTTCTTTGTTAAC
CTCTTGCCGCTCCGCTTTCAACGCCATGCATCCCAGACGATGTCGGATCTCGTTAAAGAAGCAAAGACCAAGGCT
GACGAGGCGCTGGCTCATGGCGTTCCATTCGACGTTCTCCTGGAAGAATTAAAGCTCCCTCGGTCGTCCACGTAC
AGCCCTCTGATCCAGGTGATGCTCAATTTCAAGATGGGATCCACGCGAAGTGCGCCGATTGGAGATTGTCAAGCG
GAGTTACTGGGCTTCAAGGACGCGGACAACCCTTACGACCTGGTCTTTGACGTCGAGAGCTTCCAGGATGGTTCT
ACGTGGATCAGCATCAAGACGCAGCAGTATCTGTACACGGACCACGAACTTGAACTTGTCATGAAAACATTCGTG
CGGATTCTGACGTCGTTCTCTGAGAAGCCCTGGCGGGACACAACCAACATCACCGAGCCCGGCCCCGATGAAAGA
CGAAAGACACTGGAGTTGGGGAGGGGAGCTCGAATCCCGCCCCCGAAGTTCAGCACCATCTCAGACTGCTTCCGG
AACCGGGCAGCGAGTCAACCGGACGCGATGGCCGTCACGGACGATGGCGGTGCGTCCTTGAGCTACGCCAACCTC
AACTCCATGGTCGCCAGCATAGCCGCTGCGCTGAAGCAGACCGGGCTGAGGCTCGGAGCGAGAATTTGTGTCTAC
TGTGAGCCGAGCGTTCGCATTATCGCGTGCTTCTTGGCCATTGCGCAGGTCGGAGGCGCGTACGTACCCTTGGAC
TCACAGGCTCCTGCACAGCGCCTGCAGTTGATACTCGACGACTGCGAACCGGATGTCATTATCTTTGACAAGACG
AGCTCAGTGGCGTCGCTGCGGACGGAAGCCAGGCTTCTCGACATCGAAGACATACAGGAGACGTCGGTATCGCCT
GCTGATGGCGAGAGTCAGGCACAGGAATCGGGAACTGCCTTCATTGTCTACACCAGCGGCACGTCAGGCATTCCC
AAAGGCGTAAAAATCACTCACCGCAACCTTATTCAACATAGTGACGCCGTTGTGGAGTTCTACGGCCTCAGACGA
GGCATCATGCTCCAACAAGCCCCCTTGGGTTTCGATTTGTCTCTGAGCCAGATGACGTTGTCTATCGTCACAGGA
GGCACGCTGCTCGTTGCTTCGAACGCCACCCGACGTGACCCAGCTCGGCTTGCGCGGTTGATGCGGTCCGGGCGA
GTGACGCAAACCATCATGACGCCCACACAGGCTCTGGCTCTCGTCCACCACGGCCGCGGCGAACTGATGCAGTGT
ACCGACTGGGTATTCTCGCTTCTATCGGGAGAAAGACTGCGACGTCACGTCGTCTCCGAGTTCAGGCGGCTCGGA
ATGAGTGCCTTGAAGCTGCACAATGGCTATGGCCCGACGGAAATCTCCATCAACTGTTCCGGCGGCGTGGACGAG
CTCAGCGTGACAGCCCCCTGTGACACTGTCGATCCGACGATTGGGGTGACGCTGCCCAACTACACCTGCTACATC
CTCGACGACGAGTTGCGGCCCGTCGGCACCGGACTCGCCGGCGAGCTGTTCGTCGGAGGATGTGGAGTGGCCGCG
GGTTACCTCGGGAGACCGGAGCTCACCGAGTCTAGGTTTCTGGCCGATCCGTTTGCCTCGGCGTCAGACTTGGCT
CAGGGCTGGTCCTGGATGTATCGGACAGGTGACAAGGCAAAGTTGCTGCCTGACGGCCGCATCGTCTTCCTCGGC
CGAATTACCGGAGACTCACAGATCAAACTACGCGGATTTCGAATCGAGTTGCAAGACGTGGCGACGAACATTGTC
AAGGCATCCAACGGTGCTATTTCCGACGCAGCCGTCTCGCTGCGAAAAGGGCCTGTCGCAGACCAAGATGATGGG
TTTCTGGTTGCCTTTGTCGTTCTCTCCGACACTGCGTGTTCGGAAGAGGAGCCGGAGGAGTACCTCAGGAGGCTG
CTGAGGGACTTGACTCTTTCACTGCCTCAGTACATGATCCCATCCGTCATGGGTCCGGTTGACGAGCTGCCAGTC
AATTCGTCTGGAAAGTTGGATCGACACGCTCTCGATGCTTTGCCTTTACCACGCACAGTCGAACCCGACGAGAGT
GAGCCTCTGACGACCACTCAGGAGAGGCTCAAGGCAGTGTGGCTCGAGGCCCTGCCGATGGAAACGCATATTGGG
CGCGAGACGGACTTTTTCGAAGCCGGCGGCAACTCATTGCGCCTCGTCGCGCTGCGGGAGCATGTGGCCAGGCGA
TTCGGCGTGTCTCTATCCGTCTTGGAGCTCTTTCAATGGAGCACCTTGGCGGGGATGGCCTCCAAGATCGACAGC
TCGACGGAGTCTCCGGAGCGTAGGGGCCCGATTGACTGGTCGGCAGAGACACGCGTGGAGACTACCTCCCTGGAC
TGGCCGACGGTATCGAGACAAGTTCGGCCAGCGTTTGATGTTGCCGAAGGGCTCGAGGTCGTCCTCACCGGAGCC
ACGGGGTTCCTGGGGTCGGCCATTCTCAAACAGCTCCTCCAAGACAGACGCGTGAAGCACGTCCACTGCTTGGCG
GTGCGAGATGATGCCAAAGCAGCCGAGCAGCAGGCATCCCTGGCGTCTGATCGGGTGACTTACTACGACGGAGAT
CTCGCACTACCCCGGCTCGGGCTCTCACAGCAGGTATTCGAAGAACTGTCTCGGAAAGCTCATAGGATCATCCAC
AACGGCGCCGACGTGTCGCTGCTCAAATCGTATCGATCCCTGCAAAAGGCCAACGTTGAGTCGACAAGAGAGATG
GCCCTACTGGCTGCTCCGCGTCAGGTCCCTCTGCATTTCGTCTCGTCCGGTGGCATTGCCAGCCTGGCGGGTGTC
GAGGCTCTGCCGCAGATGTCTCTGTCAGACGTCAGGCCGCCGGTGGACGGCTCTCAAGGATATGCAGCGTCAAAG
TGGGCTTCCGAGGTCTTTCTCGAGGGCTATACGCGTGAAGTCGGGACACCGACCTGGATTCATCGACCGGCTAAT
ATCACGGGAGCGGATGCACCGTCGACGGACCTGATGCAGAACCTGATTGCTTACTCGTCCAAGACGGGGGCGTTG
CCTGACGTCGGCTCCTGGAGGGGCTCGGTTGACCTGGTGCCTGTCGAGGTAGTGAGCGAGGGTATCGTGAGGACG
ATACACGAGGGGGGATCGTCAGGAAACACCGTCTTCCTACATCATTGCGCGGCAAAGAAGATTGCGGTGGATGAG
CTGGCGGCCTGGCTCGGGGTGGAAACGGTCGAACTAGACGAGTGGCTGGAGAGGGCATCGGGGGCGGGTCTTGAC
GAGACGGCGTCTCTGCTGATCAGGGGAATGCTGGAAAGGGGAGCGGGCGGTGTGGTGCCTTGTCTGCTGGGAGCT
GAGCGAGCTTTGTGA
Transcript >Ophcf2|01419
ATGAGTCTCCAGAAGCCCATCGAGGAGCCCATCGCCGTAGTCGGTGTGGCATGCCGCTTTCCAGGCGGTGCAAAC
AGTCCGTCCAAGCTCTGGGATCTCCTCTGCGAGAAACGAGATGTTCAACAGACAATCTCGCGTTTCAACGTCGAC
GGCTTTTATGACGACAACGGTGAAAAGTCGGGATGCACAAACGCAAAGAAAGCATACCTCCTGTCTGAAGACATA
CGCCTGTTTGATGCCGCCTTCTTTCGAACCAGCCCACACGAGGCGGAAAGCATGGATCCCCAGCAAAGAATCCTA
TTAGAGACAGTATACGAAGCGACCGAGGATGCTGGAATCCCGCTCAAGCCAGACGGATCCAACGTTGCCGTCTAC
GTCGGTAACATGACGGGCGACTATCATGAGATGCTGCTGCGCGATCCCCAGCATCTGCCCAAGTATATGGCGACA
GGCACCGCTAGAAGCATACTCTCGAATCGCGTGTCGTACTTCTTCAACTGGAAAGGACCGTCCGTGACCATCGAT
ACGGCCTGTTCTTCTAGCCTCGTCGCAGTGCACGAGGCGGTCACCACGCTGCGGCTGGGTGTCTCGGACGTTGCC
TGTGCGGCCGGAACGAATCTGATTCTCGGCCCGGAGATGATGATATCCGAGTCTAAGCTGCACATGCTGTCACCC
ACAGGCCGTAGTAACATGTGGTCCGCGTCCGCCGACGGATACGCCCGGGGCGAGGGCGTGGCGGCCGTCATTCTC
AAAACGCTCTCCCGGGCACTGAAAGATGGAGATCACATCCACGCACTCATTCGTGCAACTGGCGTCAACTCTGAC
GGACGTACCAGTGGCATCACGCTGCCCAGCTCTGAGTCCCAGAAGGAGCTGATTAGGAGGACGTACGCGAATGCT
GGCCTCGATTATTCTTCTGACGCGGGACGGTGCCAGTTCTTCGAAGCTCATGGAACAGGCACGCCTGCCGGGGAC
CCCATTGAAGCAAGGGCCATTCACGAGGCATTTTTCGATGATAGCAAAGGAAACCCAGAAGCGATGATTCTCGTC
GGATCGATCAAGACAGCCATTGGACACTTGGAAGGCTGTGCTGGTCTGGCAGGCCTCATCAAGGCCGTCGAAGCC
GTCCGCCGCGGCGTGGTGCCTCCGAACTTGCACTTTGATAAGCTCAATCCAGCCATCGTGCCCTATTCAAACCAC
CTGAAGATCGTCACGGACGTCTTGCCATGGCCGGAGCTGCCGCCGAACACGCCGCGTCGAGTCAGTGTTAACTCG
TTCGGCTTCGGCGGTACTAACGCGCACGCCATCGTGGAAAACTTCCAAGACAACACAACGGATAAAAGGCTCCTC
GGCGAACGTATCGTCACACCACTGGTCGTGTCTGCTAACTCGGAACACTCGCTCCGTGGACTTGTTGATGCGCTG
CGTGAGAGGCTCGGGGCCATGGATGACGACGAGGAGCTGGGCCGCATTCTCTTCACGCTCGCAGAAAGAAGGACG
CAGCTCCCGCTTCGGGCCACGTTCTCCGCACATTCGGTACAAGCCCTGCGGAAGAGACTGGAGGAAGCGACGACA
TCAGCCAGCGACGCGGAACCCATGGCCTTTCTCCAGGATGTCAGACAACCAGGCCAACGAGGGAGAATCATGGGC
GTCTTCACAGGCCAGGGAGCCCAGTGGCCGACGATGGGCCGCGAGTTGCTGCGGGAATCGGCTTTTGCTCGGAGT
CTCATGACGAAGCTGGAAGAGAGTCTTGCAGCCCTGCCGGAGCCGCCGGCTTGGAGATTGACGGAACAATGTATC
GCCGACGCCGACGCCTCCCGACTCGGTGAGGCGGCCGTCTCTCAGCCGCTGTGCACGGCCATCCAGCTCATCGTC
GTCGAGCTTCTGCGCCGCGCTGGAGTGCGCTTCAGCTGTGTTGTCGGCCATTCTTCGGGGGAGATAGCTGCTGCT
TATGCCGCTGGATTCATTTCGGTCGAGGATGCCATCCGTATCGCTTACTGTCGCGGTGTCTGTGCCGGCCTCGCC
CGGGGCTCGGACGGCCAGAGGGGGGCCATGATGGCTGCCGGTCTCCCCTACGATGAGGCTGTGAATCTTTGCAGT
GAACGATTTCCTGGACGTCTCTCTGTTGCGGCTAGTAACTCCCCGTCTGGAGTCACTTTGTCTGGGGATCAGGAC
GCTGTCGATGAGGCCGTGGCACTTCTTCAACAACGAGGGATCTTCACTCGCATCCTCAAAGTTGATACAGCATAT
CATTCATCACACATGGTTCCGTGTGCCGGCCCGTACTTATCTCTCCTCGAAGCGTGCAAAATTCGGCCGATGGCA
GGGGACCCGTCTTGCGAATGGTACTCAAGCGTCATCGGTCAACGCATGGACGGCTCCAGACATGCGGACCTCCTC
TCGGCCGAGTACTGGAAGGAGAACATGATTAAGCCAGTCTTCTTCACTCAAGCCATTGAACTAGCTGCCAAAATG
TCGGTTCCGCCTTGTCATGTCGCTCTCGAGGTTGGCCCGCACCCGGCGCTCAAGGGTCCCTTCGGACAGACGATC
AAACAAACACTGGGTGCTCAGCTGCCCTATCAGGCCACCCTTGTCCGAGGAGTTGATGATGTCGAAGCTCTGAGC
AACACTCTTGGGTTCCTGTGGTCCTGTCTCGGCAGTGATGCCGTCGACATGGTTTCTTATGCCGAGGCCTTTTCT
TCCGCCATCATCACTCGTTCTTTGGCAACAGACATACCCTCTTATCAATGGGATCACACACAGTCGTTTTGGAGA
GAACCCGCCAAATCGGTGAGGTACCGGCTTCGGAAGCACCCCCCACACCCGCTCCTCGGCGTTCGTTCGACTGAG
GATTCAGCTCATGAGTTTCGCTGGCTCAACACCCTGAGACTTTCCGACCTGCCCTGGCTGGAGGGTCATAAAGTC
GAGCAGCAAGTCATATACCCTGCAGCCGGTTATCTGGTGATGGCCATGGAAGCGGCCAAGGCATTGGACGAGAGC
ACACATGTCCGCCATGTTGAGCTATACGACGTCTCCATCTCTAGTGCTGTGCATTTGAGCTACGACTCTGCGGGC
GTGGACACCCTGTTCACATTGCGGCTCCGCGAGAGACAAGCGGAATTGAGAATCGCTCAATGGGCGTGCTACAGC
TCGCCTGCAACCGTCGACAATGGCTGGAAATGCAACGCCAGCGGCTGGCTCCGCGTGGAATTCGGCTCGCCGCCG
GCCGCCAAGAGCGCTCTGCTTCCTCCGAGAAATATCGCAGCTTGCAGCTTGAATGCTGTGGACATGGAACGCTTC
TACACATGTCTCCGCGGTATTGGTCTCGACTACACTGGCGAGTTCAAGCATCTTCATGGCGTACGAAGGAGATCG
GGAATGGCAACGGCAAAGGCGATGTATAAAGCTCCTCGCTTCCCGGCAATGATTCACCCGGCTCTACTGGACTCG
GCTTTCCAGACCCTTTTTGCTGCTTACTGCTGGCCCGACGATGGTAGTCTTCAGGTTCCCTTCGTGCCCACGTCT
CTCCGGAGTCTGAAGTTGATCAACATGAACGAATTACCTGGAGGGGAGCAGTTGGACATTGACGCTTACCTGACC
AACTCGAGGGACCGCGACCTGGCCGCTGATATTGACGTGTTCACAGCTTCGAGCGGCCGGCCGCTGATGCAGCTT
CAGGGCCTGACCTGCACATCTCTCCGCAAATTGGGTCCCCGAGACTACAAGGAGCTCTATACACAGACTGTTTGG
GAGCTTGACATCGACAGTGGTGTTGCATCTTTGGAGAATGCCAGAAGCGACAACCCCGAGGACCTCGAGTTGGTG
GATCTGTGTGAACGCCTCGCCTACTTCTATCTCAGGGATCTTCGCCGCCAAGTCGCTCCCGAGGAAGTGGCAGTA
ATGGATTGGAATTTCAAGCGCATCTTTGAGTGGATTGACGAGGAGCTGTTTCCGGCCATCGAAGCAGGGAGACAT
CCCACCATTCGGAAAGAGTGGCTTGCAGACAACCGATCGTGGCTGATGGACCAAGCGACGAAATTTGGACCCCAG
GTCGATCTTCTGCTTCTCCAGGCAGTAGGCGACAATCTCGCTGCCGTCGTTCGCAAGGAAACCACCATGCTGGAG
CACATGATCAAGGACGACGTTCTCAATCGGTTCTACAAGTCCGGACTGGGCTTTCAGAAGGCCAATGGCTACTTG
TCTCGTATCGCGAAGCAGATTGCTCACTGCCGACCGAGGATGAACATTCTGGAAATAGGTGCTGGAACTGGCGGC
GCCACGAAAGGCATCCTCGAATCACTCGGCACCACGTTTGAGAGTTACACCTTCACAGACATCTCTCCCGGCTTT
TTCGAGGCAGCCGCCGATGCCTTCGCCCCCTGGGCTTCTAAGATGACATTCAAAACTCTGGACATTGAGAAGGAC
TCGGCATCGCAAGATTTCAGTGCCGGGTACGATTTGATCATAGCTTCCAACGTCCTGCACGCTACAGAATCGCTC
TCCAACACTCTGCGCAACGTACGTCGCCTGCTCAAACCCGAGGGCCGCCTCCTGTTGCTCGAGGTCACAAGCGAC
ATCGTCCGCGTCAAGTTTATGATGTCGGGCCTTCCAGGCTGGTGGCTTGGCGGAAACGATGGCCGACGCTACGGA
CCGACCATCAGCGTCTCGCGCTGGCACTCGGAGCTCTTGTCCGCCGGATTCTCCGGAGTCGACCATGCTTTGAGA
GATTTCTCGGATCACAGGTATATGAACTCTGTCATGGTTTCCCAAGCCGTCGATGAGACCTCCCGTGTGCTTTGC
CAGCCGCTATCGAATAGTGGCGGCTGGCTGTCAGGTCATACCGTGACTATCATTGGTGGCGAGTGCAGTGGTATT
GCAAGGAACATCTCGAAAACTTTGCATCTTGCTGCGAAATCACCGTCCGATGTTGTCGTCAAAGTCGTCGAGAGA
TTCGAGCAGATGCCGTCCGATTTGCCCCCGATGAGGACAGTGCTCGTCCTGGAGGATCTCGATGACCCCCTATTT
CGAGCTATGACGTCTGAAAAGCTCGCGGCGCTGCAGCGAACCATGAATGAAGCCCGACAGGTGCTCTGGGTATCG
AGAGGATGTCGCAAGGAGGAAGCGTACGCCAGCATGTCGATCGGGTTGTGCCGAAGTTTAGCGGCAGAATTCCCT
CACGTTCAGATTCAGCACATTGACATCGAAGAGTCCGACGTGTCTATGCCCGTCGTTTCCTACCGAGTTTCGGAG
GCCCTGGCGAGGCTGATCTTCAAGTCCACTTTAAAGCAGCCGCCGCCAACGGAATCGGAGCTGACGTTGGAAAAT
GGGAAATGGCTCATCCCGCGCATTCTGCCCGACGGGCCGTTGAACGATCAGCTCAACGCCAGCAAGATGATGGTG
AAGACTCAGAGCTCTCTGGCTCATGAGACAATTGACATTTATCGATCAAAAGGCGAATTCATCGTCGCTAAGCCA
ACTCCGTCCCTTCTAGATGTTCAGAGCGCTGGGACCGGCGATATCTCGATCCATGTGGCACTGATGGCTGTCACC
CCCTTACGCGTCGATGACGATACGCCTGCCTTCCTGTCGTACGGTTTCAAGGCTGGCGACGCCTGTTCTCCAGTC
CTTGCAGTGTCTTCGACTTGCAGCTCCCGCATCTACGTGCCCGAGCACTGCGTTCTCGACTGCTCAGGCTTGGAT
GTGTCCGATCCTCCGAAGCTTCTCCGCAAGGCTCTCGTCGCTGTGGCTGCGACTCAAGTTCTTGCTGGGGTACCT
CCCGGCGCAACGGTTATACAGCACGAGGCGGACCAGTCTTTGGGCGCGGCCGTTCAATGGAAGGCAGCCGAGATG
GGAGTGAAGTGCGTCTCTACCACCTTTACAGCTTCTGAGCAGCAAGATTGCGGGAAGTCCGGACCGATCCGAATC
CATCCTAAGACTCCCGAGCGCGACTTGAAGAAGCTGTTTCCTGGCGATACCACTCTTCTCATCGACTACTCAAGT
GCCGGCAAGGCGGCTGATCTTGAGGAGTCGTCCCTGCGTCGCTGTCTGCCAACTCGCTCCAAGTTTACAGCGTCG
CAAGACATCTTTGGAGATGATGACATGACTGCGAAACAACCTAGCATCGTGGCTTCTAAACAGATCAAGGACACT
CTGCAATCAGGTCTCGATTTTGAAGTATCGGATGTTGAACGGATCATTACTGTCTCGGATCTCCCTGGCCGGGCG
ATTCTCGATACTCCTTACACGACAATTGTTGATTTTGCGTCTGCGTCACCAGTTGCAACCACTCTTCGACCACTA
GATGGCAGCCTTCTCTTCCGCCCGGACAAAACCTACCTGATGGTAGGCTGCACAGGGGGGCTTGGTCAATCGCTA
TGTCGCTGGATGGTTTCCAACGGAGTCAGAAACTTGGCTCTTACGACGAGAAACATGGCACGACTTGATTCGGGG
TGGCTCGAAGAGTTGCGATTTCAAGGTGCGACTGTACGACTCTTCGAGGTTGATGTGAGCGACAAGGATGCCCTT
GCGGCGGTACACGCCCAGATCGTGCGAAAAATGCCCCCAATATGCGGTGTTGCTCATGCCGCGATGGTGCTATCT
GATCGTTCTTTCGGCGAACTCACAAGCGACGACTTTGAGGCGGTGCTTGGGCCCAAGGTCCGAGGCACGCAGCAT
TTACACGACATCTTTCTCGACCAGCAACTTGACTTCTTCATCCTCTTCTCGTCTCTGGCAAGCATTGTGGGCAAT
CGTGGACAGTCAAACTACTCTGCGGCCAATCTGTTCATGACTGCTGTGGCCGAACAGCGCAGAGCTCGAGGCCTG
GCAGCCTCGGTGATGCACATCGGGATGGTTCTTGGTGTCGGATATGTATCCTCCAATGGCACGCACGAAGCAACT
CTCAGGCAGTACAACTACATGCCCATCTCGGAGCCCGAGTTTCTCAACATGTTTGCGCAGGCCATTCTCGTTGGT
CAGCCCACGTCGGGACACTCCCCGGAGATCATCTCGGGTCTGAATCGATACAGCCTACAGCCTGATGGACAACGC
TTCTTCTGGTCTGAGAACCAAAGATTTTGCCACCATGTCCTAGAGGAACAAAGCCAAGAAATCTGCACCGGCGAG
AACATGACTTTTTCGCAGCGTCTCGTCGAGGCGCAGTCCCCGGAGGAGATGCTGTCTGTCGTTCAGGAAGGGTTC
TGCTCAAAACTCGAACGCATGCTCCAAGCTGAGGCTGGCACGATTCGAATTTCGCAAGCCTTGATCAACCTGGGA
GTCGACTCGCTGATCGCTGCCGAGATACGATCTTGGTTCTTGAAGGAACTCGAGGTGGACATGCCTGTGCTGAGC
ATTCTGAACACGACTTCTATTGCGGATCTTTGCCTCGAAGCCGTGTGTCGGGTTTCAGAGACTCCCGGATCGAGA
GATGCTCAAGCAAACAAGATGACTGTTTTGACCGAGAAATCGCCAGATCCTGGCTACGATGGATCAGTCGCGGCG
GGATCCTCTACCGAGGCCTCACCCATCGATGTCTCGTCGGAAAGCAATGGCTTCGGCTCAAGCGCCTCGAGCGTC
GGCGGCGACACGGATTGTTCGGCCTTTGCCACTGAGCGTCCAAAGCTCGAGCGGACCGGTCGCCTATCTTTTGCT
CAAGAACGTGTTTGGTTCATGCAGCAGCTTCTTCACGGTCAGACGGCCTACAACGTCACTCTCATGTACCGCATA
AAAGGGCCTCTTCGACTATCTGAGCTCGAGAGAGCCTTTCACGCCGTCATCCGCCGTCATGAGGCTCTGCGCAGC
TGCTTTTTTGTCGATCCAGAAACAGCTTTACCGGCTCAGGGAGTCTGTCACAATAGCATCTTTGCCCTGGAAGAG
AAAACTCATGTCTCGTCAACCGCTGAGGAAGAATTCAAGCGCATTCAAGAATCGCTTTACGACCTCGAGCATGGA
CCGATTCTTCGGGCTGTAATTCACCGCTCAGCTGGCCATAATGAGCACACCCTGGTCCTCGGGTTCCCGCACATT
GCCCTTGACGGCTTCAGTGCGCAGATACTGATGCGGGACTTGGCTTTGGCGTACTCGGGCCAAGAGCTTCCTCGA
ATGCCAAACAGCTATCTGGATTACGCAGCTGAGGAGCGTGTTGCGCAGATTCCCGTCGAGAAACTTGGGTATTGG
AAGTCTGAGTTTGAGACTCTGCCGGCTGTTTTACCGTTGTTCGACTTTGCAGAATGCAGGGCTCGCGTGCCCCTG
ACGGAGTATCGGACGAGGACCATGGAACGGACGCTACCGTCTAGCATTTCGGACAGCATCAAGACTGAGGCGCGA
GAGCTCGGGGCGACGCCGTTTCACGTGTACCTGGCAGCTCTGCAGACGCTTCTCTTCGAGATGACATCGACTTCA
GATATTTGCATCGGTGTCGTTGACGCGAACAAGACGGCTGCCGCTTACATGGACACGATTGGCTTCTTTGTTAAC
CTCTTGCCGCTCCGCTTTCAACGCCATGCATCCCAGACGATGTCGGATCTCGTTAAAGAAGCAAAGACCAAGGCT
GACGAGGCGCTGGCTCATGGCGTTCCATTCGACGTTCTCCTGGAAGAATTAAAGCTCCCTCGGTCGTCCACGTAC
AGCCCTCTGATCCAGGTGATGCTCAATTTCAAGATGGGATCCACGCGAAGTGCGCCGATTGGAGATTGTCAAGCG
GAGTTACTGGGCTTCAAGGACGCGGACAACCCTTACGACCTGGTCTTTGACGTCGAGAGCTTCCAGGATGGTTCT
ACGTGGATCAGCATCAAGACGCAGCAGTATCTGTACACGGACCACGAACTTGAACTTGTCATGAAAACATTCGTG
CGGATTCTGACGTCGTTCTCTGAGAAGCCCTGGCGGGACACAACCAACATCACCGAGCCCGGCCCCGATGAAAGA
CGAAAGACACTGGAGTTGGGGAGGGGAGCTCGAATCCCGCCCCCGAAGTTCAGCACCATCTCAGACTGCTTCCGG
AACCGGGCAGCGAGTCAACCGGACGCGATGGCCGTCACGGACGATGGCGGTGCGTCCTTGAGCTACGCCAACCTC
AACTCCATGGTCGCCAGCATAGCCGCTGCGCTGAAGCAGACCGGGCTGAGGCTCGGAGCGAGAATTTGTGTCTAC
TGTGAGCCGAGCGTTCGCATTATCGCGTGCTTCTTGGCCATTGCGCAGGTCGGAGGCGCGTACGTACCCTTGGAC
TCACAGGCTCCTGCACAGCGCCTGCAGTTGATACTCGACGACTGCGAACCGGATGTCATTATCTTTGACAAGACG
AGCTCAGTGGCGTCGCTGCGGACGGAAGCCAGGCTTCTCGACATCGAAGACATACAGGAGACGTCGGTATCGCCT
GCTGATGGCGAGAGTCAGGCACAGGAATCGGGAACTGCCTTCATTGTCTACACCAGCGGCACGTCAGGCATTCCC
AAAGGCGTAAAAATCACTCACCGCAACCTTATTCAACATAGTGACGCCGTTGTGGAGTTCTACGGCCTCAGACGA
GGCATCATGCTCCAACAAGCCCCCTTGGGTTTCGATTTGTCTCTGAGCCAGATGACGTTGTCTATCGTCACAGGA
GGCACGCTGCTCGTTGCTTCGAACGCCACCCGACGTGACCCAGCTCGGCTTGCGCGGTTGATGCGGTCCGGGCGA
GTGACGCAAACCATCATGACGCCCACACAGGCTCTGGCTCTCGTCCACCACGGCCGCGGCGAACTGATGCAGTGT
ACCGACTGGGTATTCTCGCTTCTATCGGGAGAAAGACTGCGACGTCACGTCGTCTCCGAGTTCAGGCGGCTCGGA
ATGAGTGCCTTGAAGCTGCACAATGGCTATGGCCCGACGGAAATCTCCATCAACTGTTCCGGCGGCGTGGACGAG
CTCAGCGTGACAGCCCCCTGTGACACTGTCGATCCGACGATTGGGGTGACGCTGCCCAACTACACCTGCTACATC
CTCGACGACGAGTTGCGGCCCGTCGGCACCGGACTCGCCGGCGAGCTGTTCGTCGGAGGATGTGGAGTGGCCGCG
GGTTACCTCGGGAGACCGGAGCTCACCGAGTCTAGGTTTCTGGCCGATCCGTTTGCCTCGGCGTCAGACTTGGCT
CAGGGCTGGTCCTGGATGTATCGGACAGGTGACAAGGCAAAGTTGCTGCCTGACGGCCGCATCGTCTTCCTCGGC
CGAATTACCGGAGACTCACAGATCAAACTACGCGGATTTCGAATCGAGTTGCAAGACGTGGCGACGAACATTGTC
AAGGCATCCAACGGTGCTATTTCCGACGCAGCCGTCTCGCTGCGAAAAGGGCCTGTCGCAGACCAAGATGATGGG
TTTCTGGTTGCCTTTGTCGTTCTCTCCGACACTGCGTGTTCGGAAGAGGAGCCGGAGGAGTACCTCAGGAGGCTG
CTGAGGGACTTGACTCTTTCACTGCCTCAGTACATGATCCCATCCGTCATGGGTCCGGTTGACGAGCTGCCAGTC
AATTCGTCTGGAAAGTTGGATCGACACGCTCTCGATGCTTTGCCTTTACCACGCACAGTCGAACCCGACGAGAGT
GAGCCTCTGACGACCACTCAGGAGAGGCTCAAGGCAGTGTGGCTCGAGGCCCTGCCGATGGAAACGCATATTGGG
CGCGAGACGGACTTTTTCGAAGCCGGCGGCAACTCATTGCGCCTCGTCGCGCTGCGGGAGCATGTGGCCAGGCGA
TTCGGCGTGTCTCTATCCGTCTTGGAGCTCTTTCAATGGAGCACCTTGGCGGGGATGGCCTCCAAGATCGACAGC
TCGACGGAGTCTCCGGAGCGTAGGGGCCCGATTGACTGGTCGGCAGAGACACGCGTGGAGACTACCTCCCTGGAC
TGGCCGACGGTATCGAGACAAGTTCGGCCAGCGTTTGATGTTGCCGAAGGGCTCGAGGTCGTCCTCACCGGAGCC
ACGGGGTTCCTGGGGTCGGCCATTCTCAAACAGCTCCTCCAAGACAGACGCGTGAAGCACGTCCACTGCTTGGCG
GTGCGAGATGATGCCAAAGCAGCCGAGCAGCAGGCATCCCTGGCGTCTGATCGGGTGACTTACTACGACGGAGAT
CTCGCACTACCCCGGCTCGGGCTCTCACAGCAGGTATTCGAAGAACTGTCTCGGAAAGCTCATAGGATCATCCAC
AACGGCGCCGACGTGTCGCTGCTCAAATCGTATCGATCCCTGCAAAAGGCCAACGTTGAGTCGACAAGAGAGATG
GCCCTACTGGCTGCTCCGCGTCAGGTCCCTCTGCATTTCGTCTCGTCCGGTGGCATTGCCAGCCTGGCGGGTGTC
GAGGCTCTGCCGCAGATGTCTCTGTCAGACGTCAGGCCGCCGGTGGACGGCTCTCAAGGATATGCAGCGTCAAAG
TGGGCTTCCGAGGTCTTTCTCGAGGGCTATACGCGTGAAGTCGGGACACCGACCTGGATTCATCGACCGGCTAAT
ATCACGGGAGCGGATGCACCGTCGACGGACCTGATGCAGAACCTGATTGCTTACTCGTCCAAGACGGGGGCGTTG
CCTGACGTCGGCTCCTGGAGGGGCTCGGTTGACCTGGTGCCTGTCGAGGTAGTGAGCGAGGGTATCGTGAGGACG
ATACACGAGGGGGGATCGTCAGGAAACACCGTCTTCCTACATCATTGCGCGGCAAAGAAGATTGCGGTGGATGAG
CTGGCGGCCTGGCTCGGGGTGGAAACGGTCGAACTAGACGAGTGGCTGGAGAGGGCATCGGGGGCGGGTCTTGAC
GAGACGGCGTCTCTGCTGATCAGGGGAATGCTGGAAAGGGGAGCGGGCGGTGTGGTGCCTTGTCTGCTGGGAGCT
GAGCGAGCTTTGTGA
Gene >Ophcf2|01419
ATGAGTCTCCAGAAGCCCATCGAGGAGCCCATCGCCGTAGTCGGTGTGGCATGCCGCTTTCCAGGCGGTGCAAAC
AGTCCGTCCAAGCTCTGGGATCTCCTCTGCGAGAAACGAGATGTTCAACAGACAATCTCGCGTTTCAACGTCGAC
GGCTTTTATGACGACAACGGTGAAAAGTCGGGATGCACAAACGCAAAGAAAGCATACCTCCTGTCTGAAGACATA
CGCCTGTTTGATGCCGCCTTCTTTCGAACCAGCCCACACGAGGCGGAAAGCATGGATCCCCAGCAAAGAATCCTA
TTAGAGACAGTATACGAAGCGACCGAGGATGCTGGAATCCCGCTCAAGCCAGACGGATCCAACGTTGCCGTCTAC
GTCGGTAACATGACGGGCGACTATCATGAGATGCTGCTGCGCGATCCCCAGCATCTGCCCAAGTATATGGCGACA
GGCACCGCTAGAAGCATACTCTCGAATCGCGTGTCGTACTTCTTCAACTGGAAAGGACCGTCCGTGACCATCGAT
ACGGCCTGTTCTTCTAGCCTCGTCGCAGTGCACGAGGCGGTCACCACGCTGCGGCTGGGTGTCTCGGACGTTGCC
TGTGCGGCCGGAACGAATCTGATTCTCGGCCCGGAGATGATGATATCCGAGTCTAAGCTGCACATGCTGTCACCC
ACAGGCCGTAGTAACATGTGGTCCGCGTCCGCCGACGGATACGCCCGGGGCGAGGGCGTGGCGGCCGTCATTCTC
AAAACGCTCTCCCGGGCACTGAAAGATGGAGATCACATCCACGCACTCATTCGTGCAACTGGCGTCAACTCTGAC
GGACGTGAGTGGTTATCTCCCACTGCCCCTGTATAGCAATCAAGTCACTGACAGGTAATGCGAGCTACAGGTACC
AGTGGCATCACGCTGCCCAGCTCTGAGTCCCAGAAGGAGCTGATTAGGAGGACGTACGCGAATGCTGGCCTCGAT
TATTCTTCTGACGCGGGACGGTGCCAGTTCTTCGAAGCTCATGGAACAGGCACGCCTGCCGGGGACCCCATTGAA
GCAAGGGCCATTCACGAGGCATTTTTCGATGATAGCAAAGGAAACCCAGAAGCGATGATTCTCGTCGGATCGATC
AAGACAGCCATTGGACACTTGGAAGGCTGTGCTGGTCTGGCAGGCCTCATCAAGGCCGTCGAAGCCGTCCGCCGC
GGCGTGGTGCCTCCGAACTTGCACTTTGATAAGCTCAATCCAGCCATCGTGCCCTATTCAAACCACCTGAAGATC
GTCACGGACGTCTTGCCATGGCCGGAGCTGCCGCCGAACACGCCGCGTCGAGTCAGTGTTAACTCGTTCGGCTTC
GGCGGTACTAACGCGCACGCCATCGTGGAAAACTTCCAAGACAACACAACGGATAAAAGGCTCCTCGGCGAACGT
ATCGTCACACCACTGGTCGTGTCTGCTAACTCGGAACACTCGCTCCGTGGACTTGTTGATGCGCTGCGTGAGAGG
CTCGGGGCCATGGATGACGACGAGGAGCTGGGCCGCATTCTCTTCACGCTCGCAGAAAGAAGGACGCAGCTCCCG
CTTCGGGCCACGTTCTCCGCACATTCGGTACAAGCCCTGCGGAAGAGACTGGAGGAAGCGACGACATCAGCCAGC
GACGCGGAACCCATGGCCTTTCTCCAGGATGTCAGACAACCAGGCCAACGAGGGAGAATCATGGGCGTCTTCACA
GGCCAGGGAGCCCAGTGGCCGACGATGGGCCGCGAGTTGCTGCGGGAATCGGCTTTTGCTCGGAGTCTCATGACG
AAGCTGGAAGAGAGTCTTGCAGCCCTGCCGGAGCCGCCGGCTTGGAGATTGACGGAACAATGTATCGCCGACGCC
GACGCCTCCCGACTCGGTGAGGCGGCCGTCTCTCAGCCGCTGTGCACGGCCATCCAGCTCATCGTCGTCGAGCTT
CTGCGCCGCGCTGGAGTGCGCTTCAGCTGTGTTGTCGGCCATTCTTCGGGGGAGATAGCTGCTGCTTATGCCGCT
GGATTCATTTCGGTCGAGGATGCCATCCGTATCGCTTACTGTCGCGGTGTCTGTGCCGGCCTCGCCCGGGGCTCG
GACGGCCAGAGGGGGGCCATGATGGCTGCCGGTCTCCCCTACGATGAGGCTGTGAATCTTTGCAGTGAACGATTT
CCTGGACGTCTCTCTGTTGCGGCTAGTAACTCCCCGTCTGGAGTCACTTTGTCTGGGGATCAGGACGCTGTCGAT
GAGGCCGTGGCACTTCTTCAACAACGAGGGATCTTCACTCGCATCCTCAAAGTTGATACAGCATATCATTCATCA
CACATGGTTCCGTGTGCCGGCCCGTACTTATCTCTCCTCGAAGCGTGCAAAATTCGGCCGATGGCAGGGGACCCG
TCTTGCGAATGGTACTCAAGCGTCATCGGTCAACGCATGGACGGCTCCAGACATGCGGACCTCCTCTCGGCCGAG
TACTGGAAGGAGAACATGATTAAGCCAGTCTTCTTCACTCAAGCCATTGAACTAGCTGCCAAAATGTCGGTTCCG
CCTTGTCATGTCGCTCTCGAGGTTGGCCCGCACCCGGCGCTCAAGGGTCCCTTCGGACAGACGATCAAACAAACA
CTGGGTGCTCAGCTGCCCTATCAGGCCACCCTTGTCCGAGGAGTTGATGATGTCGAAGCTCTGAGCAACACTCTT
GGGTTCCTGTGGTCCTGTCTCGGCAGTGATGCCGTCGACATGGTTTCTTATGCCGAGGCCTTTTCTTCCGCCATC
ATCACTCGTTCTTTGGCAACAGACATACCCTCTTATCAATGGGATCACACACAGTCGTTTTGGAGAGAACCCGCC
AAATCGGTGAGGTACCGGCTTCGGAAGCACCCCCCACACCCGCTCCTCGGCGTTCGTTCGACTGAGGATTCAGCT
CATGAGTTTCGCTGGCTCAACACCCTGAGACTTTCCGACCTGCCCTGGCTGGAGGGTCATAAAGTCGAGCAGCAA
GTCATATACCCTGCAGCCGGTTATCTGGTGATGGCCATGGAAGCGGCCAAGGCATTGGACGAGAGCACACATGTC
CGCCATGTTGAGCTATACGACGTCTCCATCTCTAGTGCTGTGCATTTGAGCTACGACTCTGCGGGCGTGGACACC
CTGTTCACATTGCGGCTCCGCGAGAGACAAGCGGAATTGAGAATCGCTCAATGGGCGTGCTACAGCTCGCCTGCA
ACCGTCGACAATGGCTGGAAATGCAACGCCAGCGGCTGGCTCCGCGTGGAATTCGGCTCGCCGCCGGCCGCCAAG
AGCGCTCTGCTTCCTCCGAGAAATATCGCAGCTTGCAGCTTGAATGCTGTGGACATGGAACGCTTCTACACATGT
CTCCGCGGTATTGGTCTCGACTACACTGGCGAGTTCAAGCATCTTCATGGCGTACGAAGGAGATCGGGAATGGCA
ACGGCAAAGGCGATGTATAAAGCTCCTCGCTTCCCGGCAATGATTCACCCGGCTCTACTGGACTCGGCTTTCCAG
ACCCTTTTTGCTGCTTACTGCTGGCCCGACGATGGTAGTCTTCAGGTTCCCTTCGTGCCCACGTCTCTCCGGAGT
CTGAAGTTGATCAACATGAACGAATTACCTGGAGGGGAGCAGTTGGACATTGACGCTTACCTGACCAACTCGAGG
GACCGCGACCTGGCCGCTGATATTGACGTGTTCACAGCTTCGAGCGGCCGGCCGCTGATGCAGCTTCAGGGCCTG
ACCTGCACATCTCTCCGCAAATTGGGTCCCCGAGACTACAAGGAGCTCTATACACAGACTGTTTGGGAGCTTGAC
ATCGACAGTGGTGTTGCATCTTTGGAGAATGCCAGAAGCGACAACCCCGAGGACCTCGAGTTGGTGGATCTGTGT
GAACGCCTCGCCTACTTCTATCTCAGGGATCTTCGCCGCCAAGTCGCTCCCGAGGAAGTGGCAGTAATGGATTGG
AATTTCAAGCGCATCTTTGAGTGGATTGACGAGGAGCTGTTTCCGGCCATCGAAGCAGGGAGACATCCCACCATT
CGGAAAGAGTGGCTTGCAGACAACCGATCGTGGCTGATGGACCAAGCGACGAAATTTGGACCCCAGGTCGATCTT
CTGCTTCTCCAGGCAGTAGGCGACAATCTCGCTGCCGTCGTTCGCAAGGAAACCACCATGCTGGAGCACATGATC
AAGGACGACGTTCTCAATCGGTTCTACAAGTCCGGACTGGGCTTTCAGAAGGCCAATGGCTACTTGTCTCGTATC
GCGAAGCAGATTGCTCACTGCCGACCGAGGATGAACATTCTGGAAATAGGTGCTGGAACTGGCGGCGCCACGAAA
GGCATCCTCGAATCACTCGGCACCACGTTTGAGAGTTACACCTTCACAGACATCTCTCCCGGCTTTTTCGAGGCA
GCCGCCGATGCCTTCGCCCCCTGGGCTTCTAAGATGACATTCAAAACTCTGGACATTGAGAAGGACTCGGCATCG
CAAGATTTCAGTGCCGGGTACGATTTGATCATAGCTTCCAACGTCCTGCACGCTACAGAATCGCTCTCCAACACT
CTGCGCAACGTACGTCGCCTGCTCAAACCCGAGGGCCGCCTCCTGTTGCTCGAGGTCACAAGCGACATCGTCCGC
GTCAAGTTTATGATGTCGGGCCTTCCAGGCTGGTGGCTTGGCGGAAACGATGGCCGACGCTACGGACCGACCATC
AGCGTCTCGCGCTGGCACTCGGAGCTCTTGTCCGCCGGATTCTCCGGAGTCGACCATGCTTTGAGAGATTTCTCG
GATCACAGGTATATGAACTCTGTCATGGTTTCCCAAGCCGTCGATGAGACCTCCCGTGTGCTTTGCCAGCCGCTA
TCGAATAGTGGCGGCTGGCTGTCAGGTCATACCGTGACTATCATTGGTGGCGAGTGCAGTGGTATTGCAAGGAAC
ATCTCGAAAACTTTGCATCTTGCTGCGAAATCACCGTCCGATGTTGTCGTCAAAGTCGTCGAGAGATTCGAGCAG
ATGCCGTCCGATTTGCCCCCGATGAGGACAGTGCTCGTCCTGGAGGATCTCGATGACCCCCTATTTCGAGCTATG
ACGTCTGAAAAGCTCGCGGCGCTGCAGCGAACCATGAATGAAGCCCGACAGGTGCTCTGGGTATCGAGAGGATGT
CGCAAGGAGGAAGCGTACGCCAGCATGTCGATCGGGTTGTGCCGAAGTTTAGCGGCAGAATTCCCTCACGTTCAG
ATTCAGCACATTGACATCGAAGAGTCCGACGTGTCTATGCCCGTCGTTTCCTACCGAGTTTCGGAGGCCCTGGCG
AGGCTGATCTTCAAGTCCACTTTAAAGCAGCCGCCGCCAACGGAATCGGAGCTGACGTTGGAAAATGGGAAATGG
CTCATCCCGCGCATTCTGCCCGACGGGCCGTTGAACGATCAGCTCAACGCCAGCAAGATGATGGTGAAGACTCAG
AGCTCTCTGGCTCATGAGACAATTGACATTTATCGATCAAAAGGCGAATTCATCGTCGCTAAGCCAACTCCGTCC
CTTCTAGATGTTCAGAGCGCTGGGACCGGCGATATCTCGATCCATGTGGCACTGATGGCTGTCACCCCCTTACGC
GTCGATGACGATACGCCTGCCTTCCTGTCGTACGGTTTCAAGGCTGGCGACGCCTGTTCTCCAGTCCTTGCAGTG
TCTTCGACTTGCAGCTCCCGCATCTACGTGCCCGAGCACTGCGTTCTCGACTGCTCAGGCTTGGATGTGTCCGAT
CCTCCGAAGCTTCTCCGCAAGGCTCTCGTCGCTGTGGCTGCGACTCAAGTTCTTGCTGGGGTACCTCCCGGCGCA
ACGGTTATACAGCACGAGGCGGACCAGTCTTTGGGCGCGGCCGTTCAATGGAAGGCAGCCGAGATGGGAGTGAAG
TGCGTCTCTACCACCTTTACAGCTTCTGAGCAGCAAGATTGCGGGAAGTCCGGACCGATCCGAATCCATCCTAAG
ACTCCCGAGCGCGACTTGAAGAAGCTGTTTCCTGGCGATACCACTCTTCTCATCGACTACTCAAGTGCCGGCAAG
GCGGCTGATCTTGAGGAGTCGTCCCTGCGTCGCTGTCTGCCAACTCGCTCCAAGTTTACAGCGTCGCAAGACATC
TTTGGAGATGATGACATGACTGCGAAACAACCTAGCATCGTGGCTTCTAAACAGATCAAGGACACTCTGCAATCA
GGTCTCGATTTTGAAGTATCGGATGTTGAACGGATCATTACTGTCTCGGATCTCCCTGGCCGGGCGATTCTCGAT
ACTCCTTACACGACAATTGTTGATTTTGCGTCTGCGTCACCAGTTGCAACCACTCTTCGACCACTAGATGGCAGC
CTTCTCTTCCGCCCGGACAAAACCTACCTGATGGTAGGCTGCACAGGGGGGCTTGGTCAATCGCTATGTCGCTGG
ATGGTTTCCAACGGAGTCAGAAACTTGGCTCTTACGACGAGAAACATGGCACGACTTGATTCGGGGTGGCTCGAA
GAGTTGCGATTTCAAGGTGCGACTGTACGACTCTTCGAGGTTGATGTGAGCGACAAGGATGCCCTTGCGGCGGTA
CACGCCCAGATCGTGCGAAAAATGCCCCCAATATGCGGTGTTGCTCATGCCGCGATGGTGCTATCTGATCGTTCT
TTCGGCGAACTCACAAGCGACGACTTTGAGGCGGTGCTTGGGCCCAAGGTCCGAGGCACGCAGCATTTACACGAC
ATCTTTCTCGACCAGCAACTTGACTTCTTCATCCTCTTCTCGTCTCTGGCAAGCATTGTGGGCAATCGTGGACAG
TCAAACTACTCTGCGGCCAATCTGTTCATGACTGCTGTGGCCGAACAGCGCAGAGCTCGAGGCCTGGCAGCCTCG
GTGATGCACATCGGGATGGTTCTTGGTGTCGGATATGTATCCTCCAATGGCACGCACGAAGCAACTCTCAGGCAG
TACAACTACATGCCCATCTCGGAGCCCGAGTTTCTCAACATGTTTGCGCAGGCCATTCTCGTTGGTCAGCCCACG
TCGGGACACTCCCCGGAGATCATCTCGGGTCTGAATCGATACAGCCTACAGCCTGATGGACAACGCTTCTTCTGG
TCTGAGAACCAAAGATTTTGCCACCATGTCCTAGAGGAACAAAGCCAAGAAATCTGCACCGGCGAGAACATGACT
TTTTCGCAGCGTCTCGTCGAGGCGCAGTCCCCGGAGGAGATGCTGTCTGTCGTTCAGGAAGGGTTCTGCTCAAAA
CTCGAACGCATGCTCCAAGCTGAGGCTGGCACGATTCGAATTTCGCAAGCCTTGATCAACCTGGGAGTCGACTCG
CTGATCGCTGCCGAGATACGATCTTGGTTCTTGAAGGAACTCGAGGTGGACATGCCTGTGCTGAGCATTCTGAAC
ACGACTTCTATTGCGGATCTTTGCCTCGAAGCCGTGTGTCGGGTTTCAGAGACTCCCGGATCGAGAGATGCTCAA
GCAAACAAGATGACTGTTTTGACCGAGGTGAGTCTGGCATTCCGTAGATATCAGGACTCAGTGGATGACTGAGCT
CATACCTGCGCAGAAATCGCCAGATCCTGGCTACGATGGATCAGTCGCGGCGGGATCCTCTACCGAGGCCTCACC
CATCGATGTCTCGTCGGAAAGCAATGGCTTCGGCTCAAGCGCCTCGAGCGTCGGCGGCGACACGGATTGTTCGGC
CTTTGCCACTGAGCGTCCAAAGCTCGAGCGGACCGGTCGCCTATCTTTTGCTCAAGAACGTGTTTGGTTCATGCA
GCAGCTTCTTCACGGTCAGACGGCCTACAACGTCACTCTCATGTACCGCATAAAAGGGCCTCTTCGACTATCTGA
GCTCGAGAGAGCCTTTCACGCCGTCATCCGCCGTCATGAGGCTCTGCGCAGCTGCTTTTTTGTCGATCCAGAAAC
AGCTTTACCGGCTCAGGGAGTCTGTCACAATAGCATCTTTGCCCTGGAAGAGAAAACTCATGTCTCGTCAACCGC
TGAGGAAGAATTCAAGCGCATTCAAGAATCGCTTTACGACCTCGAGCATGGACCGATTCTTCGGGCTGTAATTCA
CCGCTCAGCTGGCCATAATGAGCACACCCTGGTCCTCGGGTTCCCGCACATTGCCCTTGACGGCTTCAGTGCGCA
GATACTGATGCGGGACTTGGCTTTGGCGTACTCGGGCCAAGAGCTTCCTCGAATGCCAAACAGCTATCTGGATTA
CGCAGCTGAGGAGCGTGTTGCGCAGATTCCCGTCGAGAAACTTGGGTATTGGAAGTCTGAGTTTGAGACTCTGCC
GGCTGTTTTACCGTTGTTCGACTTTGCAGAATGCAGGGCTCGCGTGCCCCTGACGGAGTATCGGACGAGGACCAT
GGAACGGACGCTACCGTCTAGCATTTCGGACAGCATCAAGACTGAGGCGCGAGAGCTCGGGGCGACGCCGTTTCA
CGTGTACCTGGCAGCTCTGCAGACGCTTCTCTTCGAGATGACATCGACTTCAGATATTTGCATCGGTGTCGTTGA
CGCGAACAAGACGGCTGCCGCTTACATGGACACGATTGGCTTCTTTGTTAACCTCTTGCCGCTCCGCTTTCAACG
CCATGCATCCCAGACGATGTCGGATCTCGTTAAAGAAGCAAAGACCAAGGCTGACGAGGCGCTGGCTCATGGCGT
TCCATTCGACGTTCTCCTGGAAGAATTAAAGCTCCCTCGGTCGTCCACGTACAGCCCTCTGATCCAGGTGATGCT
CAATTTCAAGATGGGATCCACGCGAAGTGCGCCGATTGGAGATTGTCAAGCGGAGTTACTGGGCTTCAAGGACGC
GGACAACCCTTACGACCTGGTCTTTGACGTCGAGAGCTTCCAGGATGGTTCTACGTGGATCAGCATCAAGACGCA
GCAGTATCTGTACACGGACCACGAACTTGAACTTGTCATGAAAACATTCGTGCGGATTCTGACGTCGTTCTCTGA
GAAGCCCTGGCGGGACACAACCAACATCACCGAGCCCGGCCCCGATGAAAGACGAAAGACACTGGAGTTGGGGAG
GGGAGCTCGAATCCCGCCCCCGAAGTTCAGCACCATCTCAGACTGCTTCCGGAACCGGGCAGCGAGTCAACCGGA
CGCGATGGCCGTCACGGACGATGGCGGTGCGTCCTTGAGCTACGCCAACCTCAACTCCATGGTCGCCAGCATAGC
CGCTGCGCTGAAGCAGACCGGGCTGAGGCTCGGAGCGAGAATTTGTGTCTACTGTGAGCCGAGCGTTCGCATTAT
CGCGTGCTTCTTGGCCATTGCGCAGGTCGGAGGCGCGTACGTACCCTTGGACTCACAGGCTCCTGCACAGCGCCT
GCAGTTGATACTCGACGACTGCGAACCGGATGTCATTATCTTTGACAAGACGAGCTCAGTGGCGTCGCTGCGGAC
GGAAGCCAGGCTTCTCGACATCGAAGACATACAGGAGACGTCGGTATCGCCTGCTGATGGCGAGAGTCAGGCACA
GGAATCGGGAACTGCCTTCATTGTCTACACCAGCGGCACGTCAGGCATTCCCAAAGGCGTAAAAATCACTCACCG
CAACCTTATTCAACATAGTGACGCCGTTGTGGAGTTCTACGGCCTCAGACGAGGCATCATGCTCCAACAAGCCCC
CTTGGGTTTCGATTTGTCTCTGAGCCAGATGACGTTGTCTATCGTCACAGGAGGCACGCTGCTCGTTGCTTCGAA
CGCCACCCGACGTGACCCAGCTCGGCTTGCGCGGTTGATGCGGTCCGGGCGAGTGACGCAAACCATCATGACGCC
CACACAGGCTCTGGCTCTCGTCCACCACGGCCGCGGCGAACTGATGCAGTGTACCGACTGGGTATTCTCGCTTCT
ATCGGGAGAAAGACTGCGACGTCACGTCGTCTCCGAGTTCAGGCGGCTCGGAATGAGTGCCTTGAAGCTGCACAA
TGGCTATGGCCCGACGGAAATCTCCATCAACTGTTCCGGCGGCGTGGACGAGCTCAGCGTGACAGCCCCCTGTGA
CACTGTCGATCCGACGATTGGGGTGACGCTGCCCAACTACACCTGCTACATCCTCGACGACGAGTTGCGGCCCGT
CGGCACCGGACTCGCCGGCGAGCTGTTCGTCGGAGGATGTGGAGTGGCCGCGGGTTACCTCGGGAGACCGGAGCT
CACCGAGTCTAGGTTTCTGGCCGATCCGTTTGCCTCGGCGTCAGACTTGGCTCAGGGCTGGTCCTGGATGTATCG
GACAGGTGACAAGGCAAAGTTGCTGCCTGACGGCCGCATCGTCTTCCTCGGCCGAATTACCGGAGACTCACAGAT
CAAACTACGCGGATTTCGAATCGAGTTGCAAGACGTGGCGACGAACATTGTCAAGGCATCCAACGGTGCTATTTC
CGACGCAGCCGTCTCGCTGCGAAAAGGGCCTGTCGCAGACCAAGATGATGGGTTTCTGGTTGCCTTTGTCGTTCT
CTCCGACACTGCGTGTTCGGAAGAGGAGCCGGAGGAGTACCTCAGGAGGCTGCTGAGGGACTTGACTCTTTCACT
GCCTCAGTACATGATCCCATCCGTCATGGGTCCGGTTGACGAGCTGCCAGTCAATTCGTCTGGAAAGTTGGATCG
ACACGCTCTCGATGCTTTGCCTTTACCACGCACAGTCGAACCCGACGAGAGTGAGCCTCTGACGACCACTCAGGA
GAGGCTCAAGGCAGTGTGGCTCGAGGCCCTGCCGATGGAAACGCATATTGGGCGCGAGACGGACTTTTTCGAAGC
CGGCGGCAACTCATTGCGCCTCGTCGCGCTGCGGGAGCATGTGGCCAGGCGATTCGGCGTGTCTCTATCCGTCTT
GGAGCTCTTTCAATGGAGCACCTTGGCGGGGATGGCCTCCAAGATCGACAGCTCGACGGAGTCTCCGGAGCGTAG
GGGCCCGATTGACTGGTCGGCAGAGACACGCGTGGAGACTACCTCCCTGGACTGGCCGACGGTATCGAGACAAGT
TCGGCCAGCGTTTGATGTTGCCGAAGGGCTCGAGGTCGTCCTCACCGGAGCCACGGGGTTCCTGGGGTCGGCCAT
TCTCAAACAGCTCCTCCAAGACAGACGCGTGAAGCACGTCCACTGCTTGGCGGTGCGAGATGATGCCAAAGCAGC
CGAGCAGCAGGCATCCCTGGCGTCTGATCGGGTGACTTACTACGACGGAGATCTCGCACTACCCCGGCTCGGGCT
CTCACAGCAGGTATTCGAAGAACTGTCTCGGAAAGCTCATAGGATCATCCACAACGGCGCCGACGTGTCGCTGCT
CAAATCGTATCGATCCCTGCAAAAGGCCAACGTTGAGTCGACAAGAGAGATGGCCCTACTGGCTGCTCCGCGTCA
GGTCCCTCTGCATTTCGTCTCGTCCGGTGGCATTGCCAGCCTGGCGGGTGTCGAGGCTCTGCCGCAGATGTCTCT
GTCAGACGTCAGGCCGCCGGTGGACGGCTCTCAAGGATATGCAGCGTCAAAGTGGGCTTCCGAGGTCTTTCTCGA
GGGCTATACGCGTGAAGTCGGGACACCGACCTGGATTCATCGACCGGCTAATATCACGGGAGCGGATGCACCGTC
GACGGACCTGATGCAGAACCTGATTGCTTACTCGTCCAAGACGGGGGCGTTGCCTGACGTCGGCTCCTGGAGGGG
CTCGGTTGACCTGGTGCCTGTCGAGGTAGTGAGCGAGGGTATCGTGAGGACGATACACGAGGGGGGATCGTCAGG
AAACACCGTCTTCCTACATCATTGCGCGGCAAAGAAGATTGCGGTGGATGAGCTGGCGGCCTGGCTCGGGGTGGA
AACGGTCGAACTAGACGAGTGGCTGGAGAGGGCATCGGGGGCGGGTCTTGACGAGACGGCGTCTCTGCTGATCAG
GGGAATGCTGGAAAGGGGAGCGGGCGGTGTGGTGCCTTGTCTGCTGGGAGCTGAGCGAGCTTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail