Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01404
Gene name
Locationscaffold_01:4910473..4912282
Strand-
Gene length (bp)1809
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08740 BCS1_N BCS1 N terminal 6.4E-53 48 240
PF00004 AAA ATPase family associated with various cellular activities (AAA) 3.2E-09 278 342
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.0E-05 382 427

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 37 54 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.40 0.19 2.61
Alive In ants, during behavior modification 6.11 1.17 11.04
Dead In ants, recently dead 3.17 0.89 5.45

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.017066 yes
Dead Fungus 0.022286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01404
MDTPSAPQFAILDYLLPGFSSIISAANAFLGIDIGRYLPAIVVVLGGIIAWGHVRDSLWALVEDHLMSSVRIRTD
DEIYNYVMLWLSKQRFATSSRHFLANTDINSRSSYMYRYGDSDDERDSDDDDDDDDKAKDVRGGCKALRYTPAFG
THWFWYGRQPLVFERHQNRERMSFETASEREELSLSCFGRSPRVLKELLLEARAMHLRRDKRKTLIYRGNLLTVS
WQRCMARLNRPLQTVILSERVRQDMIDDAADYLDPATRRWYANRGIPYRRGYLLYGPPGTGKSSLSLALAGYFGI
KIYMVSLSSTSATEENITTLFNDLPTRCIVLLEDIDTAGLAHTRDDAQPSSDPAPGPPPASTPTGGRPAASPPTT
VGGRLSLSGLLNILDGVASQEGRILIMTTNHVDKLDKALIRPGRVDMTIPFSLADRDMMSSIFRAIYAPYDNETS
LVGRRRCSTDTHDTEEAKLRYENNQRERERVREMAEKFANKMPELEFSPAEIQGLLLRHKRSPQVAMAAVEDWVV
RTRREKRERAEKEAAAQQTERKRQGAEKPRAGDDARDEEMKARTQTTEAKSDKETSTRGTGPLTGAKNASDSGYE
TP*
Coding >Ophcf2|01404
ATGGACACGCCCAGCGCGCCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTCCCTGCCATCGTAGTGGTGCTGGGCGGAATCATCGCC
TGGGGTCATGTGCGGGACTCGCTGTGGGCGCTTGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCTACGTCCTCGCGTCACTTTCTCGCC
AACACGGATATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCAGACGACGAGCGAGACTCGGACGAT
GATGACGACGATGACGACAAAGCCAAGGACGTCCGCGGTGGTTGCAAGGCGCTCCGATACACGCCCGCCTTTGGC
ACCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGCCACCAGAACAGGGAGCGGATGAGCTTCGAA
ACAGCCAGCGAGCGAGAGGAGCTCTCGCTGTCGTGCTTCGGCCGCAGTCCGCGCGTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCACCGTCTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGCTGCAGACCGTTATCCTCAGCGAACGCGTCAGGCAGGACATG
ATTGATGACGCGGCGGATTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGAATCCCCTACCGTCGC
GGATATCTGCTGTATGGGCCGCCTGGCACGGGTAAGAGCTCGCTGAGCCTAGCCTTGGCGGGATATTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGACTTCGGCGACCGAGGAGAACATAACGACTCTGTTCAACGACCTTCCC
ACCCGCTGCATCGTGTTGCTCGAGGACATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCCCAGCCGTCG
TCAGACCCGGCTCCGGGCCCCCCTCCGGCCTCTACGCCCACTGGCGGCCGACCGGCGGCGTCTCCTCCTACCACG
GTCGGCGGGCGCCTCTCGCTATCCGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGCATTCTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCCCTCATCCGTCCTGGCCGCGTCGACATGACGATTCCC
TTTAGCCTGGCCGACAGGGACATGATGTCCTCCATCTTCCGTGCCATATACGCCCCGTATGACAACGAGACGTCG
CTCGTTGGCCGACGGCGTTGCTCTACCGACACTCATGACACCGAAGAGGCGAAGCTGCGGTACGAGAATAACCAG
AGAGAGCGCGAGCGCGTGAGGGAAATGGCCGAGAAGTTCGCCAACAAGATGCCCGAGCTGGAGTTCAGCCCAGCC
GAGATTCAGGGTCTCTTGCTGCGGCACAAGCGGAGTCCGCAGGTAGCCATGGCCGCGGTGGAAGACTGGGTCGTC
CGCACGCGCAGGGAGAAAAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGACGGAGCGCAAGCGGCAAGGG
GCCGAGAAGCCGAGGGCAGGCGACGACGCGAGAGACGAAGAGATGAAGGCTCGGACGCAGACGACTGAAGCCAAG
AGCGACAAGGAGACGTCGACGAGAGGCACGGGCCCGTTGACGGGGGCTAAGAATGCTTCCGACTCGGGCTACGAG
ACACCCTAG
Transcript >Ophcf2|01404
ATGGACACGCCCAGCGCGCCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTCCCTGCCATCGTAGTGGTGCTGGGCGGAATCATCGCC
TGGGGTCATGTGCGGGACTCGCTGTGGGCGCTTGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCTACGTCCTCGCGTCACTTTCTCGCC
AACACGGATATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCAGACGACGAGCGAGACTCGGACGAT
GATGACGACGATGACGACAAAGCCAAGGACGTCCGCGGTGGTTGCAAGGCGCTCCGATACACGCCCGCCTTTGGC
ACCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGCCACCAGAACAGGGAGCGGATGAGCTTCGAA
ACAGCCAGCGAGCGAGAGGAGCTCTCGCTGTCGTGCTTCGGCCGCAGTCCGCGCGTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCACCGTCTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGCTGCAGACCGTTATCCTCAGCGAACGCGTCAGGCAGGACATG
ATTGATGACGCGGCGGATTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGAATCCCCTACCGTCGC
GGATATCTGCTGTATGGGCCGCCTGGCACGGGTAAGAGCTCGCTGAGCCTAGCCTTGGCGGGATATTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGACTTCGGCGACCGAGGAGAACATAACGACTCTGTTCAACGACCTTCCC
ACCCGCTGCATCGTGTTGCTCGAGGACATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCCCAGCCGTCG
TCAGACCCGGCTCCGGGCCCCCCTCCGGCCTCTACGCCCACTGGCGGCCGACCGGCGGCGTCTCCTCCTACCACG
GTCGGCGGGCGCCTCTCGCTATCCGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGCATTCTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCCCTCATCCGTCCTGGCCGCGTCGACATGACGATTCCC
TTTAGCCTGGCCGACAGGGACATGATGTCCTCCATCTTCCGTGCCATATACGCCCCGTATGACAACGAGACGTCG
CTCGTTGGCCGACGGCGTTGCTCTACCGACACTCATGACACCGAAGAGGCGAAGCTGCGGTACGAGAATAACCAG
AGAGAGCGCGAGCGCGTGAGGGAAATGGCCGAGAAGTTCGCCAACAAGATGCCCGAGCTGGAGTTCAGCCCAGCC
GAGATTCAGGGTCTCTTGCTGCGGCACAAGCGGAGTCCGCAGGTAGCCATGGCCGCGGTGGAAGACTGGGTCGTC
CGCACGCGCAGGGAGAAAAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGACGGAGCGCAAGCGGCAAGGG
GCCGAGAAGCCGAGGGCAGGCGACGACGCGAGAGACGAAGAGATGAAGGCTCGGACGCAGACGACTGAAGCCAAG
AGCGACAAGGAGACGTCGACGAGAGGCACGGGCCCGTTGACGGGGGCTAAGAATGCTTCCGACTCGGGCTACGAG
ACACCCTAG
Gene >Ophcf2|01404
ATGGACACGCCCAGCGCGCCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTCCCTGCCATCGTAGTGGTGCTGGGCGGAATCATCGCC
TGGGGTCATGTGCGGGACTCGCTGTGGGCGCTTGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCTACGTCCTCGCGTCACTTTCTCGCC
AACACGGATATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCAGACGACGAGCGAGACTCGGACGAT
GATGACGACGATGACGACAAAGCCAAGGACGTCCGCGGTGGTTGCAAGGCGCTCCGATACACGCCCGCCTTTGGC
ACCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGCCACCAGAACAGGGAGCGGATGAGCTTCGAA
ACAGCCAGCGAGCGAGAGGAGCTCTCGCTGTCGTGCTTCGGCCGCAGTCCGCGCGTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCACCGTCTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGCTGCAGACCGTTATCCTCAGCGAACGCGTCAGGCAGGACATG
ATTGATGACGCGGCGGATTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGAATCCCCTACCGTCGC
GGATATCTGCTGTATGGGCCGCCTGGCACGGGTAAGAGCTCGCTGAGCCTAGCCTTGGCGGGATATTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGACTTCGGCGACCGAGGAGAACATAACGACTCTGTTCAACGACCTTCCC
ACCCGCTGCATCGTGTTGCTCGAGGACATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCCCAGCCGTCG
TCAGACCCGGCTCCGGGCCCCCCTCCGGCCTCTACGCCCACTGGCGGCCGACCGGCGGCGTCTCCTCCTACCACG
GTCGGCGGGCGCCTCTCGCTATCCGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGCATTCTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCCCTCATCCGTCCTGGCCGCGTCGACATGACGATTCCC
TTTAGCCTGGCCGACAGGGACATGATGTCCTCCATCTTCCGTGCCATATACGCCCCGTATGACAACGAGACGTCG
CTCGTTGGCCGACGGCGTTGCTCTACCGACACTCATGACACCGAAGAGGCGAAGCTGCGGTACGAGAATAACCAG
AGAGAGCGCGAGCGCGTGAGGGAAATGGCCGAGAAGTTCGCCAACAAGATGCCCGAGCTGGAGTTCAGCCCAGCC
GAGATTCAGGGTCTCTTGCTGCGGCACAAGCGGAGTCCGCAGGTAGCCATGGCCGCGGTGGAAGACTGGGTCGTC
CGCACGCGCAGGGAGAAAAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGACGGAGCGCAAGCGGCAAGGG
GCCGAGAAGCCGAGGGCAGGCGACGACGCGAGAGACGAAGAGATGAAGGCTCGGACGCAGACGACTGAAGCCAAG
AGCGACAAGGAGACGTCGACGAGAGGCACGGGCCCGTTGACGGGGGCTAAGAATGCTTCCGACTCGGGCTACGAG
ACACCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail