Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01404
Gene name
Locationscaffold_01:4910473..4912282
Strand-
Gene length (bp)1809
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08740 BCS1_N BCS1 N terminal 6.4E-53 48 240
PF00004 AAA ATPase family associated with various cellular activities (AAA) 3.2E-09 278 342
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.0E-05 382 427

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 37 54 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01404
MDTPSAPQFAILDYLLPGFSSIISAANAFLGIDIGRYLPAIVVVLGGIIAWGHVRDSLWALVEDHLMSSVRIRTD
DEIYNYVMLWLSKQRFATSSRHFLANTDINSRSSYMYRYGDSDDERDSDDDDDDDDKAKDVRGGCKALRYTPAFG
THWFWYGRQPLVFERHQNRERMSFETASEREELSLSCFGRSPRVLKELLLEARAMHLRRDKRKTLIYRGNLLTVS
WQRCMARLNRPLQTVILSERVRQDMIDDAADYLDPATRRWYANRGIPYRRGYLLYGPPGTGKSSLSLALAGYFGI
KIYMVSLSSTSATEENITTLFNDLPTRCIVLLEDIDTAGLAHTRDDAQPSSDPAPGPPPASTPTGGRPAASPPTT
VGGRLSLSGLLNILDGVASQEGRILIMTTNHVDKLDKALIRPGRVDMTIPFSLADRDMMSSIFRAIYAPYDNETS
LVGRRRCSTDTHDTEEAKLRYENNQRERERVREMAEKFANKMPELEFSPAEIQGLLLRHKRSPQVAMAAVEDWVV
RTRREKRERAEKEAAAQQTERKRQGAEKPRAGDDARDEEMKARTQTTEAKSDKETSTRGTGPLTGAKNASDSGYE
TP*
Coding >Ophcf2|01404
ATGGACACGCCCAGCGCGCCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTCCCTGCCATCGTAGTGGTGCTGGGCGGAATCATCGCC
TGGGGTCATGTGCGGGACTCGCTGTGGGCGCTTGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCTACGTCCTCGCGTCACTTTCTCGCC
AACACGGATATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCAGACGACGAGCGAGACTCGGACGAT
GATGACGACGATGACGACAAAGCCAAGGACGTCCGCGGTGGTTGCAAGGCGCTCCGATACACGCCCGCCTTTGGC
ACCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGCCACCAGAACAGGGAGCGGATGAGCTTCGAA
ACAGCCAGCGAGCGAGAGGAGCTCTCGCTGTCGTGCTTCGGCCGCAGTCCGCGCGTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCACCGTCTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGCTGCAGACCGTTATCCTCAGCGAACGCGTCAGGCAGGACATG
ATTGATGACGCGGCGGATTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGAATCCCCTACCGTCGC
GGATATCTGCTGTATGGGCCGCCTGGCACGGGTAAGAGCTCGCTGAGCCTAGCCTTGGCGGGATATTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGACTTCGGCGACCGAGGAGAACATAACGACTCTGTTCAACGACCTTCCC
ACCCGCTGCATCGTGTTGCTCGAGGACATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCCCAGCCGTCG
TCAGACCCGGCTCCGGGCCCCCCTCCGGCCTCTACGCCCACTGGCGGCCGACCGGCGGCGTCTCCTCCTACCACG
GTCGGCGGGCGCCTCTCGCTATCCGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGCATTCTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCCCTCATCCGTCCTGGCCGCGTCGACATGACGATTCCC
TTTAGCCTGGCCGACAGGGACATGATGTCCTCCATCTTCCGTGCCATATACGCCCCGTATGACAACGAGACGTCG
CTCGTTGGCCGACGGCGTTGCTCTACCGACACTCATGACACCGAAGAGGCGAAGCTGCGGTACGAGAATAACCAG
AGAGAGCGCGAGCGCGTGAGGGAAATGGCCGAGAAGTTCGCCAACAAGATGCCCGAGCTGGAGTTCAGCCCAGCC
GAGATTCAGGGTCTCTTGCTGCGGCACAAGCGGAGTCCGCAGGTAGCCATGGCCGCGGTGGAAGACTGGGTCGTC
CGCACGCGCAGGGAGAAAAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGACGGAGCGCAAGCGGCAAGGG
GCCGAGAAGCCGAGGGCAGGCGACGACGCGAGAGACGAAGAGATGAAGGCTCGGACGCAGACGACTGAAGCCAAG
AGCGACAAGGAGACGTCGACGAGAGGCACGGGCCCGTTGACGGGGGCTAAGAATGCTTCCGACTCGGGCTACGAG
ACACCCTAG
Transcript >Ophcf2|01404
ATGGACACGCCCAGCGCGCCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTCCCTGCCATCGTAGTGGTGCTGGGCGGAATCATCGCC
TGGGGTCATGTGCGGGACTCGCTGTGGGCGCTTGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCTACGTCCTCGCGTCACTTTCTCGCC
AACACGGATATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCAGACGACGAGCGAGACTCGGACGAT
GATGACGACGATGACGACAAAGCCAAGGACGTCCGCGGTGGTTGCAAGGCGCTCCGATACACGCCCGCCTTTGGC
ACCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGCCACCAGAACAGGGAGCGGATGAGCTTCGAA
ACAGCCAGCGAGCGAGAGGAGCTCTCGCTGTCGTGCTTCGGCCGCAGTCCGCGCGTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCACCGTCTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGCTGCAGACCGTTATCCTCAGCGAACGCGTCAGGCAGGACATG
ATTGATGACGCGGCGGATTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGAATCCCCTACCGTCGC
GGATATCTGCTGTATGGGCCGCCTGGCACGGGTAAGAGCTCGCTGAGCCTAGCCTTGGCGGGATATTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGACTTCGGCGACCGAGGAGAACATAACGACTCTGTTCAACGACCTTCCC
ACCCGCTGCATCGTGTTGCTCGAGGACATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCCCAGCCGTCG
TCAGACCCGGCTCCGGGCCCCCCTCCGGCCTCTACGCCCACTGGCGGCCGACCGGCGGCGTCTCCTCCTACCACG
GTCGGCGGGCGCCTCTCGCTATCCGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGCATTCTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCCCTCATCCGTCCTGGCCGCGTCGACATGACGATTCCC
TTTAGCCTGGCCGACAGGGACATGATGTCCTCCATCTTCCGTGCCATATACGCCCCGTATGACAACGAGACGTCG
CTCGTTGGCCGACGGCGTTGCTCTACCGACACTCATGACACCGAAGAGGCGAAGCTGCGGTACGAGAATAACCAG
AGAGAGCGCGAGCGCGTGAGGGAAATGGCCGAGAAGTTCGCCAACAAGATGCCCGAGCTGGAGTTCAGCCCAGCC
GAGATTCAGGGTCTCTTGCTGCGGCACAAGCGGAGTCCGCAGGTAGCCATGGCCGCGGTGGAAGACTGGGTCGTC
CGCACGCGCAGGGAGAAAAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGACGGAGCGCAAGCGGCAAGGG
GCCGAGAAGCCGAGGGCAGGCGACGACGCGAGAGACGAAGAGATGAAGGCTCGGACGCAGACGACTGAAGCCAAG
AGCGACAAGGAGACGTCGACGAGAGGCACGGGCCCGTTGACGGGGGCTAAGAATGCTTCCGACTCGGGCTACGAG
ACACCCTAG
Gene >Ophcf2|01404
ATGGACACGCCCAGCGCGCCGCAGTTTGCCATCCTCGACTACCTCCTGCCGGGCTTCTCAAGCATCATCTCGGCA
GCCAATGCCTTTCTCGGCATCGACATCGGCCGCTACCTCCCTGCCATCGTAGTGGTGCTGGGCGGAATCATCGCC
TGGGGTCATGTGCGGGACTCGCTGTGGGCGCTTGTCGAGGACCATCTGATGTCTTCGGTACGGATCCGGACCGAC
GATGAGATTTACAACTACGTGATGCTGTGGCTGTCGAAGCAGCGGTTCGCTACGTCCTCGCGTCACTTTCTCGCC
AACACGGATATCAACTCGCGCAGCAGCTACATGTACCGATACGGAGACTCAGACGACGAGCGAGACTCGGACGAT
GATGACGACGATGACGACAAAGCCAAGGACGTCCGCGGTGGTTGCAAGGCGCTCCGATACACGCCCGCCTTTGGC
ACCCACTGGTTCTGGTACGGCCGTCAGCCTCTCGTCTTCGAGCGCCACCAGAACAGGGAGCGGATGAGCTTCGAA
ACAGCCAGCGAGCGAGAGGAGCTCTCGCTGTCGTGCTTCGGCCGCAGTCCGCGCGTGCTCAAGGAGCTGCTGCTC
GAGGCTCGCGCCATGCACCTGCGAAGGGACAAGCGAAAGACGCTCATCTACCGCGGCAACCTCCTCACCGTCTCG
TGGCAACGCTGCATGGCCCGTCTAAACAGGCCGCTGCAGACCGTTATCCTCAGCGAACGCGTCAGGCAGGACATG
ATTGATGACGCGGCGGATTATCTCGATCCGGCCACTCGCCGCTGGTACGCCAACCGGGGAATCCCCTACCGTCGC
GGATATCTGCTGTATGGGCCGCCTGGCACGGGTAAGAGCTCGCTGAGCCTAGCCTTGGCGGGATATTTTGGCATC
AAGATCTACATGGTCAGCCTGAGCTCGACTTCGGCGACCGAGGAGAACATAACGACTCTGTTCAACGACCTTCCC
ACCCGCTGCATCGTGTTGCTCGAGGACATTGATACGGCCGGCCTCGCCCATACCCGCGATGACGCCCAGCCGTCG
TCAGACCCGGCTCCGGGCCCCCCTCCGGCCTCTACGCCCACTGGCGGCCGACCGGCGGCGTCTCCTCCTACCACG
GTCGGCGGGCGCCTCTCGCTATCCGGTCTGCTCAACATTCTCGACGGCGTCGCCTCGCAGGAGGGACGCATTCTC
ATCATGACGACCAACCACGTCGACAAGCTGGACAAGGCCCTCATCCGTCCTGGCCGCGTCGACATGACGATTCCC
TTTAGCCTGGCCGACAGGGACATGATGTCCTCCATCTTCCGTGCCATATACGCCCCGTATGACAACGAGACGTCG
CTCGTTGGCCGACGGCGTTGCTCTACCGACACTCATGACACCGAAGAGGCGAAGCTGCGGTACGAGAATAACCAG
AGAGAGCGCGAGCGCGTGAGGGAAATGGCCGAGAAGTTCGCCAACAAGATGCCCGAGCTGGAGTTCAGCCCAGCC
GAGATTCAGGGTCTCTTGCTGCGGCACAAGCGGAGTCCGCAGGTAGCCATGGCCGCGGTGGAAGACTGGGTCGTC
CGCACGCGCAGGGAGAAAAGGGAGCGTGCCGAGAAAGAGGCGGCAGCCCAGCAGACGGAGCGCAAGCGGCAAGGG
GCCGAGAAGCCGAGGGCAGGCGACGACGCGAGAGACGAAGAGATGAAGGCTCGGACGCAGACGACTGAAGCCAAG
AGCGACAAGGAGACGTCGACGAGAGGCACGGGCCCGTTGACGGGGGCTAAGAATGCTTCCGACTCGGGCTACGAG
ACACCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail