Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01403
Gene name
Locationscaffold_01:4902087..4903618
Strand-
Gene length (bp)1531
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08540 HMG_CoA_synt_C Hydroxymethylglutaryl-coenzyme A synthase C terminal 2.0E-100 177 456
PF01154 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthase N terminal 4.3E-94 4 175

GO

GO Term Description Terminal node
GO:0004421 hydroxymethylglutaryl-CoA synthase activity Yes
GO:0006084 acetyl-CoA metabolic process Yes
GO:0010142 farnesyl diphosphate biosynthetic process, mevalonate pathway Yes
GO:0009150 purine ribonucleotide metabolic process No
GO:0016114 terpenoid biosynthetic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003824 catalytic activity No
GO:0006163 purine nucleotide metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006720 isoprenoid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0016746 acyltransferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046912 acyltransferase activity, acyl groups converted into alkyl on transfer No
GO:0044255 cellular lipid metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0009987 cellular process No
GO:0045337 farnesyl diphosphate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:1902767 isoprenoid biosynthetic process via mevalonate No
GO:0019637 organophosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0045338 farnesyl diphosphate metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008150 biological_process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0035383 thioester metabolic process No
GO:0006637 acyl-CoA metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0043603 cellular amide metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0008299 isoprenoid biosynthetic process No
GO:0006629 lipid metabolic process No
GO:0006721 terpenoid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4877 0.2952 0.0519 0.0128 0.5234 0.075 0.2713 0.1511 0.0295 0.0597

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup605
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4267
Ophiocordyceps australis map64 (Brazil) OphauB2|921
Ophiocordyceps camponoti-floridani Ophcf2|01403 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1053
Ophiocordyceps camponoti-rufipedis Ophun1|66
Ophiocordyceps kimflemingae Ophio5|2187
Ophiocordyceps kimflemingae Ophio5|4631
Ophiocordyceps subramaniannii Hirsu2|8487

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01403
MTSRPQNVGIKAIEIYFPSQYVEQSELEKFDGVASGKYTIGLGQTKMSFCDDREDIYSVALTVTSKLLSKYNIDP
KSIGRLEVGTETMLDKSKSVKSVLMQLFGDNANLEGVDTVNACYGGTNALFNSLNWVESSAWDGRDAIVVAGDIA
LYAKGNARPTGGAGAVAMLVGPDAPLVAEPGLRGTYMQHAYDFYKPDLTSEYPYVDGHYSLTCYTTALDAAYRDY
CRRETRLLNGSATKGNDQAENKTTPLDRFDYVAFHAPTCKLVQKSYARLLYHDYLANPDAPIFADVPPELRDMDY
EKSLTDKVVEKTFMALTKKRFQERVNPSIQVATMCGNMYCASVWGGLASLLSFADSGALQGKRIGVFSYGSGLAS
SFLSFRVRSSVDRMVKVLDVPARLEARRRVPPETYDQMCELRKRAHLRKDYTPEGDVSTMTTGAYYLVKVDDMFK
REYAIKS*
Coding >Ophcf2|01403
ATGACTTCTAGACCGCAGAACGTCGGAATCAAAGCCATCGAGATCTATTTCCCCAGCCAGTACGTCGAGCAGAGC
GAGCTCGAGAAGTTCGATGGCGTGGCTTCGGGCAAATACACCATTGGCCTGGGCCAGACCAAGATGAGCTTTTGC
GATGACCGCGAAGACATATACTCGGTCGCCCTGACCGTCACGTCCAAGCTGCTGTCCAAGTACAACATCGACCCC
AAATCCATCGGTCGGCTCGAGGTCGGCACCGAGACAATGCTCGACAAGTCCAAGTCGGTCAAGTCGGTTCTCATG
CAGCTGTTTGGGGACAACGCCAACCTCGAGGGCGTCGACACGGTCAACGCCTGCTACGGCGGCACCAACGCCCTC
TTCAACAGCCTCAACTGGGTCGAGTCTTCCGCCTGGGATGGCCGCGATGCCATCGTCGTCGCCGGCGACATCGCC
CTCTACGCAAAGGGCAACGCTCGTCCCACTGGTGGCGCCGGCGCCGTCGCCATGCTCGTCGGTCCCGATGCCCCC
CTCGTGGCCGAGCCCGGCCTGCGCGGCACCTACATGCAGCACGCCTACGACTTTTACAAGCCCGACCTTACGAGC
GAGTACCCCTACGTCGACGGTCACTACTCGCTCACCTGCTACACAACGGCCCTCGACGCCGCCTACCGCGACTAC
TGCCGCCGCGAGACCCGTCTTCTCAACGGCTCCGCCACCAAGGGCAACGACCAGGCCGAAAACAAGACGACGCCT
CTCGACCGCTTCGACTACGTCGCCTTCCACGCGCCCACCTGCAAGTTGGTCCAAAAGTCGTACGCCCGACTCCTC
TACCACGATTACCTCGCCAACCCCGACGCCCCCATCTTCGCCGACGTGCCGCCTGAGCTGCGGGACATGGACTAC
GAAAAGTCGCTGACGGACAAGGTGGTCGAGAAGACCTTTATGGCCCTGACAAAGAAGAGATTTCAGGAACGCGTC
AATCCGTCCATCCAGGTGGCCACCATGTGTGGCAATATGTACTGCGCCAGCGTCTGGGGCGGCCTCGCCAGCCTG
TTGAGCTTCGCCGATAGCGGCGCCCTCCAGGGAAAGCGCATCGGAGTCTTCAGCTACGGCTCCGGCCTCGCCTCC
AGCTTCCTGTCCTTTCGCGTCAGAAGCAGCGTCGACAGGATGGTCAAGGTCCTCGACGTACCGGCCCGTCTCGAG
GCACGACGCCGCGTCCCCCCCGAGACGTATGATCAGATGTGCGAGCTCCGCAAACGGGCTCACCTGCGCAAGGAC
TACACCCCAGAAGGCGACGTGTCTACCATGACCACTGGTGCCTATTACCTAGTAAAAGTGGACGACATGTTTAAG
CGCGAATACGCCATCAAGAGCTGA
Transcript >Ophcf2|01403
ATGACTTCTAGACCGCAGAACGTCGGAATCAAAGCCATCGAGATCTATTTCCCCAGCCAGTACGTCGAGCAGAGC
GAGCTCGAGAAGTTCGATGGCGTGGCTTCGGGCAAATACACCATTGGCCTGGGCCAGACCAAGATGAGCTTTTGC
GATGACCGCGAAGACATATACTCGGTCGCCCTGACCGTCACGTCCAAGCTGCTGTCCAAGTACAACATCGACCCC
AAATCCATCGGTCGGCTCGAGGTCGGCACCGAGACAATGCTCGACAAGTCCAAGTCGGTCAAGTCGGTTCTCATG
CAGCTGTTTGGGGACAACGCCAACCTCGAGGGCGTCGACACGGTCAACGCCTGCTACGGCGGCACCAACGCCCTC
TTCAACAGCCTCAACTGGGTCGAGTCTTCCGCCTGGGATGGCCGCGATGCCATCGTCGTCGCCGGCGACATCGCC
CTCTACGCAAAGGGCAACGCTCGTCCCACTGGTGGCGCCGGCGCCGTCGCCATGCTCGTCGGTCCCGATGCCCCC
CTCGTGGCCGAGCCCGGCCTGCGCGGCACCTACATGCAGCACGCCTACGACTTTTACAAGCCCGACCTTACGAGC
GAGTACCCCTACGTCGACGGTCACTACTCGCTCACCTGCTACACAACGGCCCTCGACGCCGCCTACCGCGACTAC
TGCCGCCGCGAGACCCGTCTTCTCAACGGCTCCGCCACCAAGGGCAACGACCAGGCCGAAAACAAGACGACGCCT
CTCGACCGCTTCGACTACGTCGCCTTCCACGCGCCCACCTGCAAGTTGGTCCAAAAGTCGTACGCCCGACTCCTC
TACCACGATTACCTCGCCAACCCCGACGCCCCCATCTTCGCCGACGTGCCGCCTGAGCTGCGGGACATGGACTAC
GAAAAGTCGCTGACGGACAAGGTGGTCGAGAAGACCTTTATGGCCCTGACAAAGAAGAGATTTCAGGAACGCGTC
AATCCGTCCATCCAGGTGGCCACCATGTGTGGCAATATGTACTGCGCCAGCGTCTGGGGCGGCCTCGCCAGCCTG
TTGAGCTTCGCCGATAGCGGCGCCCTCCAGGGAAAGCGCATCGGAGTCTTCAGCTACGGCTCCGGCCTCGCCTCC
AGCTTCCTGTCCTTTCGCGTCAGAAGCAGCGTCGACAGGATGGTCAAGGTCCTCGACGTACCGGCCCGTCTCGAG
GCACGACGCCGCGTCCCCCCCGAGACGTATGATCAGATGTGCGAGCTCCGCAAACGGGCTCACCTGCGCAAGGAC
TACACCCCAGAAGGCGACGTGTCTACCATGACCACTGGTGCCTATTACCTAGTAAAAGTGGACGACATGTTTAAG
CGCGAATACGCCATCAAGAGCTGA
Gene >Ophcf2|01403
ATGACTTCTAGACCGCAGAACGTCGGAATCAAAGCCATCGAGATCTATTTCCCCAGCCAGGTCTGTTTCTCTGCC
ATCAGTCTCATCCGATCCCTGACTCTTCAGCTACAGTACGTCGAGCAGAGCGAGCTCGAGAAGTTCGATGGCGTG
GCTTCGGGCAAATACACCATTGGCCTGGGCCAGACCAAGATGAGCTTTTGCGATGACCGCGAAGGTCCTTCTATT
CTCTTGCTGGAGCCCTCGAAAACCGCCTGGCTGACGGCTAGCAGACATATACTCGGTCGCCCTGACCGTCACGTC
CAAGCTGCTGTCCAAGTACAACATCGACCCCAAATCCATCGGTCGGCTCGAGGTCGGCACCGAGACAATGCTCGA
CAAGTCCAAGTCGGTCAAGTCGGTTCTCATGCAGCTGTTTGGGGACAACGCCAACCTCGAGGGCGTCGACACGGT
CAACGCCTGCTACGGCGGCACCAACGCCCTCTTCAACAGCCTCAACTGGGTCGAGTCTTCCGCCTGGGATGGCCG
CGATGCCATCGTCGTCGCCGGCGACATCGCCCTCTACGCAAAGGGCAACGCTCGTCCCACTGGTGGCGCCGGCGC
CGTCGCCATGCTCGTCGGTCCCGATGCCCCCCTCGTGGCCGAGCCCGGCCTGCGCGGCACCTACATGCAGCACGC
CTACGACTTTTACAAGCCCGACCTTACGAGCGAGTACCCCTACGTCGACGGTCACTACTCGCTCACCTGCTACAC
AACGGCCCTCGACGCCGCCTACCGCGACTACTGCCGCCGCGAGACCCGTCTTCTCAACGGCTCCGCCACCAAGGG
CAACGACCAGGCCGAAAACAAGACGACGCCTCTCGACCGCTTCGACTACGTCGCCTTCCACGCGCCCACCTGCAA
GTTGGTCCAAAAGTCGTACGCCCGACTCCTCTACCACGATTACCTCGCCAACCCCGACGCCCCCATCTTCGCCGA
CGTGCCGCCTGAGCTGCGGGACATGGACTACGAAAAGTCGCTGACGGACAAGGTGGTCGAGAAGACCTTTATGGC
CCTGACAAAGAAGAGATTTCAGGAACGCGTCAATCCGTCCATCCAGGTGGCCACCATGTGTGGCAATATGTACTG
CGCCAGCGTCTGGGGCGGCCTCGCCAGCCTGTTGAGCTTCGCCGATAGCGGCGCCCTCCAGGGAAAGCGCATCGG
AGTCTTCAGCTACGGCTCCGGCCTCGCCTCCAGCTTCCTGTCCTTTCGCGTCAGAAGCAGCGTCGACAGGATGGT
CAAGGTCCTCGACGTACCGGCCCGTCTCGAGGCACGACGCCGCGTCCCCCCCGAGACGTATGATCAGGTAGGTCG
TCCCGTTCTTTCCTTTGATATGAACGGAGCTGATCATGGATAGATGTGCGAGCTCCGCAAACGGGCTCACCTGCG
CAAGGACTACACCCCAGAAGGCGACGTGTCTACCATGACCACTGGTGCCTATTACCTAGTAAAAGTGGACGACAT
GTTTAAGCGCGAATACGCCATCAAGAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail