Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01398
Gene name
Locationscaffold_01:4893376..4894680
Strand-
Gene length (bp)1304
Transcript length (bp)1182
Coding sequence length (bp)1182
Protein length (aa) 394

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 5.5E-28 116 349
PF13483 Lactamase_B_3 Beta-lactamase superfamily domain 6.2E-09 100 180

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.541 0.342 0.0514 0.0876 0.626 0.3146 0.1447 0.3917 0.2729 0.0759

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4748
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4262
Ophiocordyceps australis map64 (Brazil) OphauB2|553
Ophiocordyceps australis map64 (Brazil) OphauB2|706
Ophiocordyceps australis map64 (Brazil) OphauB2|926
Ophiocordyceps camponoti-floridani Ophcf2|01398 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1057
Ophiocordyceps kimflemingae Ophio5|2192

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01398
MASSPPTVTSVSKLSSPAGPVPEDAASKPHHVLRRGVLSRFRNPHPSYPASIGFGTIVRNLVWPLITGQLKLPDT
SKPALRVRQPAWLPSRTASDRLRATWLGHACCYVEFPSGLRVLFDPVLEDRCSPFTVVGPKRYTPQPCSPADIPA
VDAVVISHSHYDHLSLASVVGIQRRHPHVHFFVGLGLETWFRRGGLRNVTELDWWEDAELTVEAGSADGPGTRIS
ARVSCLPCQHTSGRTPFDRDRTLWCSWAVRSGHRSVWFGGDTGYRAVPRLPPGSDDYGPTFSALLPRCPHFRHIG
DLRGPFDLGLIPIGAYHPRVAFSGMHANPFDAVEIFAETRCRFALAIHWGTWALTLEHVDEPPILLREALRRRDL
PEEGVFDVCEIGESREFP*
Coding >Ophcf2|01398
ATGGCATCTTCGCCGCCAACAGTGACGTCAGTCTCCAAGCTATCAAGCCCAGCCGGTCCCGTCCCCGAAGACGCA
GCCTCCAAACCCCATCACGTCCTCCGACGCGGCGTCCTATCCCGTTTCCGTAACCCGCATCCGTCGTACCCGGCC
TCCATCGGGTTCGGGACGATTGTGCGAAACTTGGTTTGGCCTCTCATCACCGGCCAGCTCAAGCTGCCGGACACG
AGCAAACCAGCCCTCCGCGTCAGACAACCAGCCTGGCTCCCCTCACGAACGGCATCAGACCGTCTAAGAGCAACC
TGGCTCGGCCACGCGTGCTGCTACGTCGAATTCCCCTCCGGTCTGCGCGTGCTCTTCGACCCCGTCCTGGAAGAT
CGCTGCTCGCCCTTTACCGTGGTAGGGCCGAAGAGGTACACGCCTCAGCCTTGCTCACCGGCCGATATACCGGCG
GTAGACGCCGTCGTCATCAGCCACAGTCACTACGATCACCTCTCGCTGGCGTCCGTCGTGGGCATCCAACGTCGG
CATCCGCACGTGCATTTCTTCGTCGGGCTCGGGCTGGAGACGTGGTTTCGTCGGGGCGGGCTGCGGAACGTCACG
GAGCTGGATTGGTGGGAAGACGCCGAGCTGACGGTCGAGGCCGGATCCGCAGACGGGCCCGGGACCCGCATCTCG
GCCCGCGTCTCCTGTCTCCCTTGCCAGCATACGTCGGGCCGGACCCCCTTCGACCGGGACCGAACACTGTGGTGC
TCTTGGGCCGTCCGCTCCGGCCATCGGTCCGTCTGGTTCGGCGGCGATACGGGCTACCGTGCCGTTCCGCGCCTC
CCCCCGGGCAGCGACGACTACGGGCCGACCTTTTCGGCCCTTCTCCCCCGGTGTCCGCACTTCCGTCACATCGGC
GACCTGCGCGGACCCTTTGATCTCGGCCTCATCCCCATCGGCGCCTACCATCCACGCGTTGCCTTCTCCGGCATG
CACGCCAACCCGTTTGACGCCGTCGAGATCTTCGCCGAGACTCGCTGTCGCTTCGCCTTGGCCATTCATTGGGGA
ACCTGGGCTCTGACGCTCGAGCACGTCGACGAGCCGCCCATTCTCCTGCGGGAGGCGCTTCGTCGTCGAGACTTG
CCTGAAGAGGGCGTCTTTGACGTCTGCGAGATTGGGGAGAGTCGCGAGTTTCCCTGA
Transcript >Ophcf2|01398
ATGGCATCTTCGCCGCCAACAGTGACGTCAGTCTCCAAGCTATCAAGCCCAGCCGGTCCCGTCCCCGAAGACGCA
GCCTCCAAACCCCATCACGTCCTCCGACGCGGCGTCCTATCCCGTTTCCGTAACCCGCATCCGTCGTACCCGGCC
TCCATCGGGTTCGGGACGATTGTGCGAAACTTGGTTTGGCCTCTCATCACCGGCCAGCTCAAGCTGCCGGACACG
AGCAAACCAGCCCTCCGCGTCAGACAACCAGCCTGGCTCCCCTCACGAACGGCATCAGACCGTCTAAGAGCAACC
TGGCTCGGCCACGCGTGCTGCTACGTCGAATTCCCCTCCGGTCTGCGCGTGCTCTTCGACCCCGTCCTGGAAGAT
CGCTGCTCGCCCTTTACCGTGGTAGGGCCGAAGAGGTACACGCCTCAGCCTTGCTCACCGGCCGATATACCGGCG
GTAGACGCCGTCGTCATCAGCCACAGTCACTACGATCACCTCTCGCTGGCGTCCGTCGTGGGCATCCAACGTCGG
CATCCGCACGTGCATTTCTTCGTCGGGCTCGGGCTGGAGACGTGGTTTCGTCGGGGCGGGCTGCGGAACGTCACG
GAGCTGGATTGGTGGGAAGACGCCGAGCTGACGGTCGAGGCCGGATCCGCAGACGGGCCCGGGACCCGCATCTCG
GCCCGCGTCTCCTGTCTCCCTTGCCAGCATACGTCGGGCCGGACCCCCTTCGACCGGGACCGAACACTGTGGTGC
TCTTGGGCCGTCCGCTCCGGCCATCGGTCCGTCTGGTTCGGCGGCGATACGGGCTACCGTGCCGTTCCGCGCCTC
CCCCCGGGCAGCGACGACTACGGGCCGACCTTTTCGGCCCTTCTCCCCCGGTGTCCGCACTTCCGTCACATCGGC
GACCTGCGCGGACCCTTTGATCTCGGCCTCATCCCCATCGGCGCCTACCATCCACGCGTTGCCTTCTCCGGCATG
CACGCCAACCCGTTTGACGCCGTCGAGATCTTCGCCGAGACTCGCTGTCGCTTCGCCTTGGCCATTCATTGGGGA
ACCTGGGCTCTGACGCTCGAGCACGTCGACGAGCCGCCCATTCTCCTGCGGGAGGCGCTTCGTCGTCGAGACTTG
CCTGAAGAGGGCGTCTTTGACGTCTGCGAGATTGGGGAGAGTCGCGAGTTTCCCTGA
Gene >Ophcf2|01398
ATGGCATCTTCGCCGCCAACAGTGACGTCAGTCTCCAAGCTATCAAGCCCAGCCGGTCCCGTCCCCGAAGACGCA
GCCTCCAAACCCCATCACGTCCTCCGACGCGGCGTCCTATCCCGTTTCCGTAACCCGCATCCGTCGTACCCGGCC
TCCATCGGGTTCGGGACGATTGTGCGAAACTTGGTTTGGTACGCGGCTCCCTCCCATCATAACTTCCCTTCTCTA
CAACCGTCTCGAATCATGACTTCCCCTTCCCTATAACCATCTTCTATCCGCTGAACATTCAGACGCTACGCCATG
GACTTGTCAGGCCTCTCATCACCGGCCAGCTCAAGCTGCCGGACACGAGCAAACCAGCCCTCCGCGTCAGACAAC
CAGCCTGGCTCCCCTCACGAACGGCATCAGACCGTCTAAGAGCAACCTGGCTCGGCCACGCGTGCTGCTACGTCG
AATTCCCCTCCGGTCTGCGCGTGCTCTTCGACCCCGTCCTGGAAGATCGCTGCTCGCCCTTTACCGTGGTAGGGC
CGAAGAGGTACACGCCTCAGCCTTGCTCACCGGCCGATATACCGGCGGTAGACGCCGTCGTCATCAGCCACAGTC
ACTACGATCACCTCTCGCTGGCGTCCGTCGTGGGCATCCAACGTCGGCATCCGCACGTGCATTTCTTCGTCGGGC
TCGGGCTGGAGACGTGGTTTCGTCGGGGCGGGCTGCGGAACGTCACGGAGCTGGATTGGTGGGAAGACGCCGAGC
TGACGGTCGAGGCCGGATCCGCAGACGGGCCCGGGACCCGCATCTCGGCCCGCGTCTCCTGTCTCCCTTGCCAGC
ATACGTCGGGCCGGACCCCCTTCGACCGGGACCGAACACTGTGGTGCTCTTGGGCCGTCCGCTCCGGCCATCGGT
CCGTCTGGTTCGGCGGCGATACGGGCTACCGTGCCGTTCCGCGCCTCCCCCCGGGCAGCGACGACTACGGGCCGA
CCTTTTCGGCCCTTCTCCCCCGGTGTCCGCACTTCCGTCACATCGGCGACCTGCGCGGACCCTTTGATCTCGGCC
TCATCCCCATCGGCGCCTACCATCCACGCGTTGCCTTCTCCGGCATGCACGCCAACCCGTTTGACGCCGTCGAGA
TCTTCGCCGAGACTCGCTGTCGCTTCGCCTTGGCCATTCATTGGGGAACCTGGGCTCTGACGCTCGAGCACGTCG
ACGAGCCGCCCATTCTCCTGCGGGAGGCGCTTCGTCGTCGAGACTTGCCTGAAGAGGGCGTCTTTGACGTCTGCG
AGATTGGGGAGAGTCGCGAGTTTCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail