Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01391
Gene name
Locationscaffold_01:4876217..4878115
Strand-
Gene length (bp)1898
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 92 114 22
4 146 168 22
5 203 225 22
6 246 268 22
7 288 310 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 32.73 17.99 47.48
Alive In ants, during behavior modification 36.58 20.19 52.97
Dead In ants, recently dead 22.75 11.71 33.79

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.622524 no
Alive Dead 0.005578 yes
Dead Fungus 0.076869 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01391
MDHLTVYTLPTSPPRWDRVGVFYMSFGASWTALVVAGMAFCLYHRRNPILRLRGLGLSFGAISLLHVYWILAQIV
YPVASTVPIVLAYDIQYFVMGMYFPLGIALFHASNSRFLHVAKLQMQFTQGAPARKPSVGWFASVPYMVKLMTVI
SMGMIVQVIACVGMWLLCRKYHPTFGLLGTEMKAQTLPAQIVELGRGWEWWPSVLWQLIWAWIVAPVLIWRAWGI
RDTMGWRTQTIGCCLSNLHATPMFLIASYVPAFAPVNLYFAPSQWYGVRLELCIGSWLTSSSIRIHLSVFMFEIF
TVFVPAFEVVRLGIQKRRVANLNAKWDAESTTSTLTPGDWRKRSTVHIGGDKSRWTLDEELGDRLLSMSALEHVL
ASNPGPLQEFSALSDFSGENIAFLTRTASWKSSWTDAGEQRLQVYNSALEIYVSFVSPRDAEFPLNLSSAKLRRL
EAVFEIPARILYGEARTDLATPFADDSFGPNQSRLTAQYTGEIPDGFGPDVFEEAIQHIKSLVLTNTWPKFIDEM
QSPRRKSTETTWTGISANSQSTLASRLSKQLSRLMKK*
Coding >Ophcf2|01391
ATGGATCACTTGACCGTCTACACGCTGCCGACGAGCCCTCCCCGCTGGGACAGGGTCGGCGTCTTCTACATGTCC
TTTGGCGCCTCGTGGACGGCCCTCGTCGTGGCAGGCATGGCCTTTTGCCTCTATCACCGCCGCAACCCGATCCTG
AGGCTCCGTGGCCTGGGCCTGTCGTTCGGCGCCATTTCTCTGCTTCACGTCTACTGGATACTGGCCCAGATCGTG
TATCCCGTCGCCAGCACCGTCCCCATCGTCCTGGCCTATGATATCCAGTACTTCGTCATGGGAATGTACTTTCCG
CTGGGAATCGCTCTGTTTCACGCCTCCAACAGCCGCTTCCTGCACGTTGCCAAGCTGCAGATGCAGTTCACCCAG
GGAGCTCCGGCCCGGAAGCCCAGCGTCGGCTGGTTCGCCAGCGTGCCGTACATGGTGAAGCTCATGACGGTCATT
AGCATGGGCATGATCGTCCAGGTCATCGCTTGCGTCGGCATGTGGCTTCTGTGTAGGAAATACCATCCCACCTTT
GGCCTCCTCGGCACAGAGATGAAAGCACAAACTCTTCCAGCGCAGATCGTCGAGCTCGGCCGCGGTTGGGAATGG
TGGCCTTCGGTGCTGTGGCAGCTCATCTGGGCCTGGATTGTTGCTCCCGTCCTCATCTGGCGTGCCTGGGGCATC
CGCGATACCATGGGTTGGCGGACTCAGACCATCGGCTGCTGTCTCTCCAATCTCCACGCGACGCCCATGTTTCTC
ATCGCCTCCTACGTACCCGCTTTTGCGCCCGTCAATCTTTACTTTGCCCCAAGCCAATGGTATGGCGTCCGACTC
GAGCTCTGCATAGGGTCTTGGCTGACGTCGAGCTCCATCAGGATTCATCTGTCCGTCTTCATGTTCGAAATCTTC
ACAGTCTTCGTCCCCGCCTTCGAGGTCGTCAGGCTCGGCATCCAGAAAAGAAGGGTTGCCAACCTCAACGCCAAG
TGGGATGCCGAGTCGACGACGTCGACGCTGACGCCCGGTGACTGGCGGAAGCGATCGACGGTACACATAGGCGGC
GACAAGTCCAGGTGGACGCTCGATGAGGAACTCGGCGATCGCCTCCTAAGCATGAGCGCCCTCGAGCACGTCCTC
GCCTCGAACCCCGGCCCACTGCAGGAGTTTTCTGCCCTGAGCGATTTCTCGGGAGAGAATATCGCCTTCCTGACG
CGCACAGCCTCGTGGAAGTCGTCCTGGACCGACGCCGGCGAGCAGAGACTCCAAGTATACAACTCAGCGCTCGAA
ATCTACGTCAGTTTCGTCAGCCCCCGCGACGCCGAGTTCCCCTTGAACCTCTCGTCCGCCAAGCTCCGCCGTCTC
GAGGCCGTCTTCGAGATTCCGGCGAGAATTTTGTATGGCGAGGCCCGCACTGATCTGGCCACGCCCTTTGCCGAC
GATTCTTTCGGGCCGAATCAGAGCCGTTTGACGGCGCAGTATACGGGCGAGATCCCAGATGGATTCGGTCCGGAC
GTCTTTGAAGAGGCCATCCAACATATCAAGTCTCTCGTCCTAACCAACACTTGGCCCAAGTTCATCGATGAGATG
CAATCGCCGAGGAGGAAGTCGACCGAAACGACCTGGACCGGCATCAGCGCCAACTCGCAGTCCACGCTGGCCAGT
CGACTCTCGAAGCAATTATCGAGACTGATGAAGAAGTAG
Transcript >Ophcf2|01391
ATGGATCACTTGACCGTCTACACGCTGCCGACGAGCCCTCCCCGCTGGGACAGGGTCGGCGTCTTCTACATGTCC
TTTGGCGCCTCGTGGACGGCCCTCGTCGTGGCAGGCATGGCCTTTTGCCTCTATCACCGCCGCAACCCGATCCTG
AGGCTCCGTGGCCTGGGCCTGTCGTTCGGCGCCATTTCTCTGCTTCACGTCTACTGGATACTGGCCCAGATCGTG
TATCCCGTCGCCAGCACCGTCCCCATCGTCCTGGCCTATGATATCCAGTACTTCGTCATGGGAATGTACTTTCCG
CTGGGAATCGCTCTGTTTCACGCCTCCAACAGCCGCTTCCTGCACGTTGCCAAGCTGCAGATGCAGTTCACCCAG
GGAGCTCCGGCCCGGAAGCCCAGCGTCGGCTGGTTCGCCAGCGTGCCGTACATGGTGAAGCTCATGACGGTCATT
AGCATGGGCATGATCGTCCAGGTCATCGCTTGCGTCGGCATGTGGCTTCTGTGTAGGAAATACCATCCCACCTTT
GGCCTCCTCGGCACAGAGATGAAAGCACAAACTCTTCCAGCGCAGATCGTCGAGCTCGGCCGCGGTTGGGAATGG
TGGCCTTCGGTGCTGTGGCAGCTCATCTGGGCCTGGATTGTTGCTCCCGTCCTCATCTGGCGTGCCTGGGGCATC
CGCGATACCATGGGTTGGCGGACTCAGACCATCGGCTGCTGTCTCTCCAATCTCCACGCGACGCCCATGTTTCTC
ATCGCCTCCTACGTACCCGCTTTTGCGCCCGTCAATCTTTACTTTGCCCCAAGCCAATGGTATGGCGTCCGACTC
GAGCTCTGCATAGGGTCTTGGCTGACGTCGAGCTCCATCAGGATTCATCTGTCCGTCTTCATGTTCGAAATCTTC
ACAGTCTTCGTCCCCGCCTTCGAGGTCGTCAGGCTCGGCATCCAGAAAAGAAGGGTTGCCAACCTCAACGCCAAG
TGGGATGCCGAGTCGACGACGTCGACGCTGACGCCCGGTGACTGGCGGAAGCGATCGACGGTACACATAGGCGGC
GACAAGTCCAGGTGGACGCTCGATGAGGAACTCGGCGATCGCCTCCTAAGCATGAGCGCCCTCGAGCACGTCCTC
GCCTCGAACCCCGGCCCACTGCAGGAGTTTTCTGCCCTGAGCGATTTCTCGGGAGAGAATATCGCCTTCCTGACG
CGCACAGCCTCGTGGAAGTCGTCCTGGACCGACGCCGGCGAGCAGAGACTCCAAGTATACAACTCAGCGCTCGAA
ATCTACGTCAGTTTCGTCAGCCCCCGCGACGCCGAGTTCCCCTTGAACCTCTCGTCCGCCAAGCTCCGCCGTCTC
GAGGCCGTCTTCGAGATTCCGGCGAGAATTTTGTATGGCGAGGCCCGCACTGATCTGGCCACGCCCTTTGCCGAC
GATTCTTTCGGGCCGAATCAGAGCCGTTTGACGGCGCAGTATACGGGCGAGATCCCAGATGGATTCGGTCCGGAC
GTCTTTGAAGAGGCCATCCAACATATCAAGTCTCTCGTCCTAACCAACACTTGGCCCAAGTTCATCGATGAGATG
CAATCGCCGAGGAGGAAGTCGACCGAAACGACCTGGACCGGCATCAGCGCCAACTCGCAGTCCACGCTGGCCAGT
CGACTCTCGAAGCAATTATCGAGACTGATGAAGAAGTAG
Gene >Ophcf2|01391
ATGGATCACTTGACCGTCTACACGCTGCCGACGAGCCCTCCCCGCTGGGACAGGGTCGGCGTCTTCTACATGTCC
TTTGGCGCCTCGTGGACGGCCCTCGTCGTGGCAGGCATGGCCTTTTGCCTCTATCACCGCCGCAACCCGATCCTG
AGGCTCCGTGGCCTGGGCCTGTCGTTCGGCGCCATTTCTCTGCTTCACGTCTACTGGATACTGGCCCAGATCGTG
TATCCCGTCGCCAGCACCGTCCCCATCGTCCTGGCCTATGATATCCAGTACTTCGTCATGGGAATGTACTTTCCG
CTGGGAATCGCTCTGTTTCACGCCTCCAACAGCCGCTTCCTGCACGTTGCCAAGCTGCAGATGCAGTTCACCCAG
GGAGCTCCGGCCCGGAAGCCCAGCGTCGGCTGGTTCGCCAGCGTGCCGTACATGGTGAAGCTCATGACGGTCATT
AGCATGGGCATGATCGTCCAGGTCTGCTCCATTCTCTCCCTCTCCCTCCCTCCCTCTCACTCTCTCTATCCTCCT
CCTCTCTCCCGGCTCAGCCGTCTCTCTGCTGACGTTTGGAACGCAGGTCATCGCTTGCGTCGGCATGTGGCTTCT
GTGTAGGAAATACCATCCCACCTTTGGCCTCCTCGGCACAGAGATGAAAGCACAAACTCTTCCAGCGCAGATCGT
CGAGCTCGGCCGCGGTTGGGAATGGTGGCCTTCGGTGCTGTGGCAGCTCATCTGGGCCTGGATTGTGCGTCATAA
ACTCGGCTCTCTCCATCGACTTCTCGCTGACGAGATGGCTCAGGTTGCTCCCGTCCTCATCTGGCGTGCCTGGGG
CATCCGCGATACCATGGGTTGGCGGACTCAGACCATCGGCTGCTGTCTCTCCAAGTGCGTCTCCGAGTTTCGTCT
TCCGAATGCCTCACCCTAACTTTGCCACCTTCAGTCTCCACGCGACGCCCATGTTTCTCATCGCCTCCTACGTAC
CCGCTTTTGCGCCCGTCAATCTTTACTTTGCCCCAAGCCAATGGTATGGCGTCCGACTCGAGCTCTGCATAGGGT
CTTGGCTGACGTCGAGCTCCATCAGGATTCATCTGTCCGTCTTCATGTTCGAAATCTTCACAGTCTTCGTCCCCG
CCTTCGAGGTCGTCAGGCTCGGCATCCAGAAAAGAAGGGTTGCCAACCTCAACGCCAAGTGGGATGCCGAGTCGA
CGACGTCGACGCTGACGCCCGGTGACTGGCGGAAGCGATCGACGGTACACATAGGCGGCGACAAGTCCAGGTGGA
CGCTCGATGAGGAACTCGGCGATCGCCTCCTAAGCATGAGCGCCCTCGAGCACGTCCTCGCCTCGAACCCCGGCC
CACTGCAGGAGTTTTCTGCCCTGAGCGATTTCTCGGGAGAGAATATCGCCTTCCTGACGCGCACAGCCTCGTGGA
AGTCGTCCTGGACCGACGCCGGCGAGCAGAGACTCCAAGTATACAACTCAGCGCTCGAAATCTACGTCAGTTTCG
TCAGCCCCCGCGACGCCGAGTTCCCCTTGAACCTCTCGTCCGCCAAGCTCCGCCGTCTCGAGGCCGTCTTCGAGA
TTCCGGCGAGAATTTTGTATGGCGAGGCCCGCACTGATCTGGCCACGCCCTTTGCCGACGATTCTTTCGGGCCGA
ATCAGAGCCGTTTGACGGCGCAGTATACGGGCGAGATCCCAGATGGATTCGGTCCGGACGTCTTTGAAGAGGCCA
TCCAACATATCAAGTCTCTCGTCCTAACCAACACTTGGCCCAAGTTCATCGATGAGATGCAATCGCCGAGGAGGA
AGTCGACCGAAACGACCTGGACCGGCATCAGCGCCAACTCGCAGTCCACGCTGGCCAGTCGACTCTCGAAGCAAT
TATCGAGACTGATGAAGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail