Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01388
Gene name
Locationscaffold_01:4867844..4871666
Strand+
Gene length (bp)3822
Transcript length (bp)3822
Coding sequence length (bp)3822
Protein length (aa) 1274

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16414 NPC1_N Niemann-Pick C1 N terminus 1.9E-80 28 261
PF02460 Patched Patched family 2.1E-43 519 869
PF02460 Patched Patched family 2.9E-25 1006 1232
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 5.0E-51 627 779
PF03176 MMPL MMPL family 7.5E-06 634 782

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 265 287 22
2 596 618 22
3 633 655 22
4 662 684 22
5 741 763 22
6 826 843 17
7 1070 1092 22
8 1099 1121 22
9 1125 1147 22
10 1175 1197 22
11 1212 1234 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01388
MRHRFAPLLLAAAPLLLAEPLTPKHEPGRCAMRGQCGKQSLFGKQLPCVDNDVAREPDSELRKEIVDLCGAEWSH
SPVCCTLDQVQALKSELGTPKTLIGSCPACKQNFFNLFCKFACSPDQSLFVNVTASVEKSGKHLVTEIDQLISEE
YGSGFYDSCKEVKFGGANTRAMDLIGGGAKDYHQLLKFLGDKKPFVGSPFQINFPESYGDAHMGPLKDMHPKSCN
DSDPNYRCVCVDCPQVCPKLPVVDKQGSCRVGALPCLSFASIFTYCVLLSAMMASVFGHVAWKRYAQHQAERTRL
LHGSSHSDDEDEGGPVLTEAARDRPTRRYWLNDQCDKAFGGLGHAAARFPGLTIGTSLVVVAILSAGWFRFDLEK
EPARLWVSPSSAAAQEKQYFDTNFGPFYRAEKIFLVNDTLPSGPGPVLSYETLKWWSEVEQGIERIVSPTFRDSL
QDVCYRPANDACVVQSVTSYWWARGGISPTGWKDQLRSCARSPVDCRPKFGQPIDPSMVLGGYGGGDDDDDDVVD
ARALTVTWVVNNGQGGTAALARAIDWENALRDRLLEVQEEAEVRGLRLSFSTEISLEQELNRSTNTDAKIVVISY
VVMFIYACMALGTPLKHVFRNPALLLVESKVTLGLAGILIVLMSMAASIGFFSWVGLKATLIIVEVIPFIVLAVG
VDNIFLIVHELERVNASCPDQMVEERVARALGRMGPSILLSALTETVAFALGAAVGMPAVRNFAAYAAGAVLVNA
LLQMTMFVSLLALNQMRVEDHRCELWPWWQVTKARVHMDGTNGFVSSGRHDDEEGPLQVFIKNTYAPRLLRRKFK
LAVVAVFLAVFAAGLALLPRLQLGLDQRVAIPDGSYLIPYFDDVYDYLETGPPLYFVTRRVDASRRPEQQQLCSR
FTTCQPLSLTNRLELERQRPDVSYIASPTASWIDDFFLWLNPVYDHCCVDKGSPCFANRQPPWNTTLSGMPEGAE
FFRYLDRFLSSPADDDCPLGGQAAYGDAVVVDRNEAAVRASHFRTAHTPLRSQADFIEAYAAARRIADDVSRQTG
ADVFPYSVFYIFFDQYLSMVPLAAGLLSATVVIILAMACLLLGSVRTSVVVAATVVMTVVDIMGAMALMGVSLNA
VSLVNLIICVGISVEFCAHVARAFTFPSRTVMEANNNAFRGRDARAWTALVNVGGSVFSGITITKLLGVCVLAFT
SSKIFEVYYFRVWLALVIFAALHALVFLPVALGFAGGRGYVDPESEGTAAQDLTDRRWRAIRVHDNSDSDDGF*
Coding >Ophcf2|01388
ATGCGTCATCGGTTCGCGCCTCTGCTCCTGGCGGCCGCGCCTTTACTCCTGGCCGAGCCCTTAACGCCGAAACAT
GAACCCGGACGATGCGCCATGCGCGGCCAGTGTGGCAAGCAGAGTCTGTTCGGCAAGCAGTTGCCTTGCGTCGAC
AACGATGTCGCGCGTGAGCCCGATTCGGAGCTCCGCAAGGAGATTGTCGACCTCTGCGGCGCTGAATGGAGCCAT
TCTCCCGTCTGCTGCACGCTCGACCAGGTTCAGGCGCTCAAGTCGGAGCTCGGTACGCCCAAAACGCTCATCGGC
TCCTGTCCGGCATGCAAGCAAAACTTCTTCAACCTCTTCTGCAAGTTTGCCTGCTCTCCCGACCAGTCTCTCTTC
GTCAACGTCACCGCCTCGGTCGAAAAGAGCGGCAAGCACCTCGTGACCGAGATCGATCAGCTGATATCCGAGGAA
TACGGCTCCGGCTTCTACGATAGCTGCAAGGAAGTCAAGTTTGGCGGCGCCAACACGAGGGCCATGGACTTGATC
GGCGGTGGCGCAAAGGACTACCACCAGCTGCTCAAGTTTCTCGGCGACAAGAAGCCCTTTGTCGGCTCTCCCTTC
CAGATCAACTTCCCCGAATCATACGGCGACGCCCACATGGGTCCTCTCAAGGACATGCACCCAAAGAGCTGCAAC
GACTCTGATCCAAACTACCGCTGCGTCTGCGTCGACTGTCCCCAAGTCTGTCCCAAGCTGCCCGTCGTCGACAAG
CAGGGCTCCTGCAGAGTCGGCGCCCTTCCGTGTCTGTCGTTCGCCTCCATCTTCACCTACTGCGTCCTTCTCTCG
GCCATGATGGCGTCCGTCTTCGGCCACGTCGCGTGGAAGAGGTACGCCCAACACCAGGCCGAGAGGACCAGGCTT
CTCCACGGGTCGTCCCACAGCGACGACGAGGACGAGGGCGGGCCGGTCCTGACGGAAGCCGCCCGCGATCGTCCC
ACCAGGCGATACTGGCTCAACGACCAGTGCGACAAGGCCTTTGGCGGGCTCGGGCATGCGGCCGCTCGCTTCCCC
GGCCTGACAATCGGAACCAGCCTCGTCGTCGTCGCCATCCTCAGCGCCGGCTGGTTCAGGTTCGACCTGGAGAAG
GAGCCCGCCCGGCTATGGGTCAGCCCGTCGTCGGCCGCCGCTCAGGAGAAGCAATATTTCGACACCAATTTCGGC
CCCTTTTACCGCGCCGAGAAGATCTTCCTCGTCAACGACACCCTACCGTCAGGGCCGGGCCCGGTCCTGAGCTAC
GAGACTCTCAAGTGGTGGTCCGAGGTGGAGCAGGGCATCGAGCGCATCGTCAGCCCGACCTTCCGAGACAGCCTC
CAGGACGTGTGCTACAGACCGGCCAATGACGCGTGCGTGGTCCAGTCCGTCACGTCGTACTGGTGGGCGCGCGGA
GGCATCAGCCCTACCGGCTGGAAGGATCAGCTCCGGAGCTGTGCCAGGTCTCCGGTCGACTGCAGACCCAAGTTC
GGGCAGCCCATCGATCCCAGCATGGTGCTTGGCGGATACGGCGGCGGCGACGACGACGACGACGACGTGGTCGAT
GCCCGGGCTCTCACCGTCACGTGGGTGGTCAACAACGGTCAGGGGGGCACGGCGGCGCTGGCCAGGGCCATTGAC
TGGGAGAACGCGCTCCGCGACCGGCTGCTCGAGGTGCAGGAAGAGGCCGAGGTCAGGGGGCTCCGGCTGTCCTTT
AGCACCGAGATCAGCCTGGAGCAGGAGCTCAACAGGTCGACCAACACCGACGCCAAGATTGTCGTCATCAGCTAC
GTCGTCATGTTCATCTACGCCTGCATGGCGCTGGGAACGCCCTTGAAGCACGTGTTCCGGAACCCGGCGCTGTTG
CTGGTCGAGTCCAAGGTGACGCTGGGCCTCGCGGGAATCCTCATCGTGCTCATGTCCATGGCCGCCTCCATCGGC
TTCTTCTCGTGGGTCGGGCTCAAGGCGACGCTCATCATCGTCGAGGTGATACCCTTTATCGTGCTGGCCGTCGGC
GTCGACAACATCTTCCTCATCGTCCACGAGTTGGAGCGCGTCAACGCCAGCTGCCCGGACCAGATGGTCGAGGAG
CGCGTGGCGAGGGCTCTGGGTCGCATGGGACCGTCGATACTGCTGTCGGCCCTGACGGAGACGGTGGCCTTTGCG
CTGGGGGCGGCCGTCGGGATGCCGGCCGTGCGCAACTTCGCCGCCTATGCCGCCGGCGCGGTGCTGGTCAACGCG
CTGCTTCAGATGACCATGTTCGTCTCCCTGCTGGCTCTCAACCAGATGCGCGTCGAGGATCACCGGTGCGAGCTG
TGGCCGTGGTGGCAGGTGACCAAGGCTCGCGTCCACATGGACGGCACCAACGGCTTCGTCTCGAGCGGCCGTCAC
GACGATGAGGAGGGACCGCTGCAGGTGTTCATAAAGAACACGTACGCGCCTCGGCTGCTGCGAAGAAAGTTCAAG
CTGGCCGTCGTCGCCGTCTTCCTGGCCGTCTTCGCCGCCGGACTCGCTCTACTACCGCGACTGCAGCTGGGGCTT
GATCAGCGCGTCGCCATCCCGGACGGCTCCTATCTCATCCCCTACTTCGACGACGTGTACGACTACCTCGAGACT
GGACCGCCTCTCTATTTCGTCACCCGCCGAGTCGACGCGTCCCGGAGGCCGGAGCAGCAGCAGCTGTGCTCGCGC
TTCACGACGTGCCAGCCCCTTTCGCTGACCAACCGGCTCGAGCTCGAACGGCAGCGTCCCGACGTGTCGTACATC
GCCTCGCCCACCGCCAGCTGGATAGACGACTTCTTCCTCTGGCTCAACCCCGTCTACGACCACTGCTGCGTCGAC
AAGGGGTCGCCGTGCTTCGCCAACCGCCAACCCCCCTGGAACACGACGCTATCCGGCATGCCCGAGGGCGCAGAG
TTCTTCCGCTACCTCGACAGGTTCCTCTCCTCGCCCGCCGACGACGACTGCCCCCTAGGCGGCCAGGCCGCGTAC
GGAGACGCCGTCGTGGTGGACCGGAACGAGGCGGCGGTGCGGGCCAGCCACTTCCGGACGGCCCACACGCCGCTC
CGGAGCCAGGCCGACTTCATCGAGGCCTACGCGGCCGCCAGACGGATCGCCGACGACGTTTCCCGCCAGACGGGC
GCCGACGTGTTCCCCTACAGCGTCTTCTACATCTTCTTCGACCAGTACCTGTCCATGGTGCCCCTCGCGGCCGGT
CTCCTCTCGGCAACGGTGGTCATCATCCTGGCCATGGCCTGTCTGCTGCTCGGCTCCGTCCGGACGTCTGTCGTG
GTGGCGGCGACGGTCGTCATGACAGTCGTCGACATCATGGGCGCCATGGCCCTCATGGGCGTCTCCCTCAACGCC
GTCTCCCTCGTCAACCTCATCATCTGCGTCGGCATCTCGGTCGAGTTCTGCGCTCACGTAGCCCGAGCCTTTACG
TTCCCCTCTCGCACCGTCATGGAAGCCAACAACAACGCCTTCCGCGGCCGCGACGCCCGCGCCTGGACCGCCCTC
GTCAACGTCGGCGGCTCCGTCTTCTCCGGCATCACCATCACCAAGCTCCTCGGCGTCTGCGTCCTGGCCTTTACG
AGCTCCAAGATCTTTGAGGTTTACTACTTCCGCGTCTGGCTCGCTCTCGTCATCTTTGCCGCCCTGCACGCGCTC
GTCTTCCTGCCCGTTGCCCTTGGCTTCGCCGGTGGTCGTGGCTACGTCGATCCCGAGAGCGAGGGGACTGCTGCT
CAGGACCTTACCGATAGGAGGTGGCGGGCTATTCGGGTTCATGACAATAGCGACTCTGATGACGGGTTTTGA
Transcript >Ophcf2|01388
ATGCGTCATCGGTTCGCGCCTCTGCTCCTGGCGGCCGCGCCTTTACTCCTGGCCGAGCCCTTAACGCCGAAACAT
GAACCCGGACGATGCGCCATGCGCGGCCAGTGTGGCAAGCAGAGTCTGTTCGGCAAGCAGTTGCCTTGCGTCGAC
AACGATGTCGCGCGTGAGCCCGATTCGGAGCTCCGCAAGGAGATTGTCGACCTCTGCGGCGCTGAATGGAGCCAT
TCTCCCGTCTGCTGCACGCTCGACCAGGTTCAGGCGCTCAAGTCGGAGCTCGGTACGCCCAAAACGCTCATCGGC
TCCTGTCCGGCATGCAAGCAAAACTTCTTCAACCTCTTCTGCAAGTTTGCCTGCTCTCCCGACCAGTCTCTCTTC
GTCAACGTCACCGCCTCGGTCGAAAAGAGCGGCAAGCACCTCGTGACCGAGATCGATCAGCTGATATCCGAGGAA
TACGGCTCCGGCTTCTACGATAGCTGCAAGGAAGTCAAGTTTGGCGGCGCCAACACGAGGGCCATGGACTTGATC
GGCGGTGGCGCAAAGGACTACCACCAGCTGCTCAAGTTTCTCGGCGACAAGAAGCCCTTTGTCGGCTCTCCCTTC
CAGATCAACTTCCCCGAATCATACGGCGACGCCCACATGGGTCCTCTCAAGGACATGCACCCAAAGAGCTGCAAC
GACTCTGATCCAAACTACCGCTGCGTCTGCGTCGACTGTCCCCAAGTCTGTCCCAAGCTGCCCGTCGTCGACAAG
CAGGGCTCCTGCAGAGTCGGCGCCCTTCCGTGTCTGTCGTTCGCCTCCATCTTCACCTACTGCGTCCTTCTCTCG
GCCATGATGGCGTCCGTCTTCGGCCACGTCGCGTGGAAGAGGTACGCCCAACACCAGGCCGAGAGGACCAGGCTT
CTCCACGGGTCGTCCCACAGCGACGACGAGGACGAGGGCGGGCCGGTCCTGACGGAAGCCGCCCGCGATCGTCCC
ACCAGGCGATACTGGCTCAACGACCAGTGCGACAAGGCCTTTGGCGGGCTCGGGCATGCGGCCGCTCGCTTCCCC
GGCCTGACAATCGGAACCAGCCTCGTCGTCGTCGCCATCCTCAGCGCCGGCTGGTTCAGGTTCGACCTGGAGAAG
GAGCCCGCCCGGCTATGGGTCAGCCCGTCGTCGGCCGCCGCTCAGGAGAAGCAATATTTCGACACCAATTTCGGC
CCCTTTTACCGCGCCGAGAAGATCTTCCTCGTCAACGACACCCTACCGTCAGGGCCGGGCCCGGTCCTGAGCTAC
GAGACTCTCAAGTGGTGGTCCGAGGTGGAGCAGGGCATCGAGCGCATCGTCAGCCCGACCTTCCGAGACAGCCTC
CAGGACGTGTGCTACAGACCGGCCAATGACGCGTGCGTGGTCCAGTCCGTCACGTCGTACTGGTGGGCGCGCGGA
GGCATCAGCCCTACCGGCTGGAAGGATCAGCTCCGGAGCTGTGCCAGGTCTCCGGTCGACTGCAGACCCAAGTTC
GGGCAGCCCATCGATCCCAGCATGGTGCTTGGCGGATACGGCGGCGGCGACGACGACGACGACGACGTGGTCGAT
GCCCGGGCTCTCACCGTCACGTGGGTGGTCAACAACGGTCAGGGGGGCACGGCGGCGCTGGCCAGGGCCATTGAC
TGGGAGAACGCGCTCCGCGACCGGCTGCTCGAGGTGCAGGAAGAGGCCGAGGTCAGGGGGCTCCGGCTGTCCTTT
AGCACCGAGATCAGCCTGGAGCAGGAGCTCAACAGGTCGACCAACACCGACGCCAAGATTGTCGTCATCAGCTAC
GTCGTCATGTTCATCTACGCCTGCATGGCGCTGGGAACGCCCTTGAAGCACGTGTTCCGGAACCCGGCGCTGTTG
CTGGTCGAGTCCAAGGTGACGCTGGGCCTCGCGGGAATCCTCATCGTGCTCATGTCCATGGCCGCCTCCATCGGC
TTCTTCTCGTGGGTCGGGCTCAAGGCGACGCTCATCATCGTCGAGGTGATACCCTTTATCGTGCTGGCCGTCGGC
GTCGACAACATCTTCCTCATCGTCCACGAGTTGGAGCGCGTCAACGCCAGCTGCCCGGACCAGATGGTCGAGGAG
CGCGTGGCGAGGGCTCTGGGTCGCATGGGACCGTCGATACTGCTGTCGGCCCTGACGGAGACGGTGGCCTTTGCG
CTGGGGGCGGCCGTCGGGATGCCGGCCGTGCGCAACTTCGCCGCCTATGCCGCCGGCGCGGTGCTGGTCAACGCG
CTGCTTCAGATGACCATGTTCGTCTCCCTGCTGGCTCTCAACCAGATGCGCGTCGAGGATCACCGGTGCGAGCTG
TGGCCGTGGTGGCAGGTGACCAAGGCTCGCGTCCACATGGACGGCACCAACGGCTTCGTCTCGAGCGGCCGTCAC
GACGATGAGGAGGGACCGCTGCAGGTGTTCATAAAGAACACGTACGCGCCTCGGCTGCTGCGAAGAAAGTTCAAG
CTGGCCGTCGTCGCCGTCTTCCTGGCCGTCTTCGCCGCCGGACTCGCTCTACTACCGCGACTGCAGCTGGGGCTT
GATCAGCGCGTCGCCATCCCGGACGGCTCCTATCTCATCCCCTACTTCGACGACGTGTACGACTACCTCGAGACT
GGACCGCCTCTCTATTTCGTCACCCGCCGAGTCGACGCGTCCCGGAGGCCGGAGCAGCAGCAGCTGTGCTCGCGC
TTCACGACGTGCCAGCCCCTTTCGCTGACCAACCGGCTCGAGCTCGAACGGCAGCGTCCCGACGTGTCGTACATC
GCCTCGCCCACCGCCAGCTGGATAGACGACTTCTTCCTCTGGCTCAACCCCGTCTACGACCACTGCTGCGTCGAC
AAGGGGTCGCCGTGCTTCGCCAACCGCCAACCCCCCTGGAACACGACGCTATCCGGCATGCCCGAGGGCGCAGAG
TTCTTCCGCTACCTCGACAGGTTCCTCTCCTCGCCCGCCGACGACGACTGCCCCCTAGGCGGCCAGGCCGCGTAC
GGAGACGCCGTCGTGGTGGACCGGAACGAGGCGGCGGTGCGGGCCAGCCACTTCCGGACGGCCCACACGCCGCTC
CGGAGCCAGGCCGACTTCATCGAGGCCTACGCGGCCGCCAGACGGATCGCCGACGACGTTTCCCGCCAGACGGGC
GCCGACGTGTTCCCCTACAGCGTCTTCTACATCTTCTTCGACCAGTACCTGTCCATGGTGCCCCTCGCGGCCGGT
CTCCTCTCGGCAACGGTGGTCATCATCCTGGCCATGGCCTGTCTGCTGCTCGGCTCCGTCCGGACGTCTGTCGTG
GTGGCGGCGACGGTCGTCATGACAGTCGTCGACATCATGGGCGCCATGGCCCTCATGGGCGTCTCCCTCAACGCC
GTCTCCCTCGTCAACCTCATCATCTGCGTCGGCATCTCGGTCGAGTTCTGCGCTCACGTAGCCCGAGCCTTTACG
TTCCCCTCTCGCACCGTCATGGAAGCCAACAACAACGCCTTCCGCGGCCGCGACGCCCGCGCCTGGACCGCCCTC
GTCAACGTCGGCGGCTCCGTCTTCTCCGGCATCACCATCACCAAGCTCCTCGGCGTCTGCGTCCTGGCCTTTACG
AGCTCCAAGATCTTTGAGGTTTACTACTTCCGCGTCTGGCTCGCTCTCGTCATCTTTGCCGCCCTGCACGCGCTC
GTCTTCCTGCCCGTTGCCCTTGGCTTCGCCGGTGGTCGTGGCTACGTCGATCCCGAGAGCGAGGGGACTGCTGCT
CAGGACCTTACCGATAGGAGGTGGCGGGCTATTCGGGTTCATGACAATAGCGACTCTGATGACGGGTTTTGA
Gene >Ophcf2|01388
ATGCGTCATCGGTTCGCGCCTCTGCTCCTGGCGGCCGCGCCTTTACTCCTGGCCGAGCCCTTAACGCCGAAACAT
GAACCCGGACGATGCGCCATGCGCGGCCAGTGTGGCAAGCAGAGTCTGTTCGGCAAGCAGTTGCCTTGCGTCGAC
AACGATGTCGCGCGTGAGCCCGATTCGGAGCTCCGCAAGGAGATTGTCGACCTCTGCGGCGCTGAATGGAGCCAT
TCTCCCGTCTGCTGCACGCTCGACCAGGTTCAGGCGCTCAAGTCGGAGCTCGGTACGCCCAAAACGCTCATCGGC
TCCTGTCCGGCATGCAAGCAAAACTTCTTCAACCTCTTCTGCAAGTTTGCCTGCTCTCCCGACCAGTCTCTCTTC
GTCAACGTCACCGCCTCGGTCGAAAAGAGCGGCAAGCACCTCGTGACCGAGATCGATCAGCTGATATCCGAGGAA
TACGGCTCCGGCTTCTACGATAGCTGCAAGGAAGTCAAGTTTGGCGGCGCCAACACGAGGGCCATGGACTTGATC
GGCGGTGGCGCAAAGGACTACCACCAGCTGCTCAAGTTTCTCGGCGACAAGAAGCCCTTTGTCGGCTCTCCCTTC
CAGATCAACTTCCCCGAATCATACGGCGACGCCCACATGGGTCCTCTCAAGGACATGCACCCAAAGAGCTGCAAC
GACTCTGATCCAAACTACCGCTGCGTCTGCGTCGACTGTCCCCAAGTCTGTCCCAAGCTGCCCGTCGTCGACAAG
CAGGGCTCCTGCAGAGTCGGCGCCCTTCCGTGTCTGTCGTTCGCCTCCATCTTCACCTACTGCGTCCTTCTCTCG
GCCATGATGGCGTCCGTCTTCGGCCACGTCGCGTGGAAGAGGTACGCCCAACACCAGGCCGAGAGGACCAGGCTT
CTCCACGGGTCGTCCCACAGCGACGACGAGGACGAGGGCGGGCCGGTCCTGACGGAAGCCGCCCGCGATCGTCCC
ACCAGGCGATACTGGCTCAACGACCAGTGCGACAAGGCCTTTGGCGGGCTCGGGCATGCGGCCGCTCGCTTCCCC
GGCCTGACAATCGGAACCAGCCTCGTCGTCGTCGCCATCCTCAGCGCCGGCTGGTTCAGGTTCGACCTGGAGAAG
GAGCCCGCCCGGCTATGGGTCAGCCCGTCGTCGGCCGCCGCTCAGGAGAAGCAATATTTCGACACCAATTTCGGC
CCCTTTTACCGCGCCGAGAAGATCTTCCTCGTCAACGACACCCTACCGTCAGGGCCGGGCCCGGTCCTGAGCTAC
GAGACTCTCAAGTGGTGGTCCGAGGTGGAGCAGGGCATCGAGCGCATCGTCAGCCCGACCTTCCGAGACAGCCTC
CAGGACGTGTGCTACAGACCGGCCAATGACGCGTGCGTGGTCCAGTCCGTCACGTCGTACTGGTGGGCGCGCGGA
GGCATCAGCCCTACCGGCTGGAAGGATCAGCTCCGGAGCTGTGCCAGGTCTCCGGTCGACTGCAGACCCAAGTTC
GGGCAGCCCATCGATCCCAGCATGGTGCTTGGCGGATACGGCGGCGGCGACGACGACGACGACGACGTGGTCGAT
GCCCGGGCTCTCACCGTCACGTGGGTGGTCAACAACGGTCAGGGGGGCACGGCGGCGCTGGCCAGGGCCATTGAC
TGGGAGAACGCGCTCCGCGACCGGCTGCTCGAGGTGCAGGAAGAGGCCGAGGTCAGGGGGCTCCGGCTGTCCTTT
AGCACCGAGATCAGCCTGGAGCAGGAGCTCAACAGGTCGACCAACACCGACGCCAAGATTGTCGTCATCAGCTAC
GTCGTCATGTTCATCTACGCCTGCATGGCGCTGGGAACGCCCTTGAAGCACGTGTTCCGGAACCCGGCGCTGTTG
CTGGTCGAGTCCAAGGTGACGCTGGGCCTCGCGGGAATCCTCATCGTGCTCATGTCCATGGCCGCCTCCATCGGC
TTCTTCTCGTGGGTCGGGCTCAAGGCGACGCTCATCATCGTCGAGGTGATACCCTTTATCGTGCTGGCCGTCGGC
GTCGACAACATCTTCCTCATCGTCCACGAGTTGGAGCGCGTCAACGCCAGCTGCCCGGACCAGATGGTCGAGGAG
CGCGTGGCGAGGGCTCTGGGTCGCATGGGACCGTCGATACTGCTGTCGGCCCTGACGGAGACGGTGGCCTTTGCG
CTGGGGGCGGCCGTCGGGATGCCGGCCGTGCGCAACTTCGCCGCCTATGCCGCCGGCGCGGTGCTGGTCAACGCG
CTGCTTCAGATGACCATGTTCGTCTCCCTGCTGGCTCTCAACCAGATGCGCGTCGAGGATCACCGGTGCGAGCTG
TGGCCGTGGTGGCAGGTGACCAAGGCTCGCGTCCACATGGACGGCACCAACGGCTTCGTCTCGAGCGGCCGTCAC
GACGATGAGGAGGGACCGCTGCAGGTGTTCATAAAGAACACGTACGCGCCTCGGCTGCTGCGAAGAAAGTTCAAG
CTGGCCGTCGTCGCCGTCTTCCTGGCCGTCTTCGCCGCCGGACTCGCTCTACTACCGCGACTGCAGCTGGGGCTT
GATCAGCGCGTCGCCATCCCGGACGGCTCCTATCTCATCCCCTACTTCGACGACGTGTACGACTACCTCGAGACT
GGACCGCCTCTCTATTTCGTCACCCGCCGAGTCGACGCGTCCCGGAGGCCGGAGCAGCAGCAGCTGTGCTCGCGC
TTCACGACGTGCCAGCCCCTTTCGCTGACCAACCGGCTCGAGCTCGAACGGCAGCGTCCCGACGTGTCGTACATC
GCCTCGCCCACCGCCAGCTGGATAGACGACTTCTTCCTCTGGCTCAACCCCGTCTACGACCACTGCTGCGTCGAC
AAGGGGTCGCCGTGCTTCGCCAACCGCCAACCCCCCTGGAACACGACGCTATCCGGCATGCCCGAGGGCGCAGAG
TTCTTCCGCTACCTCGACAGGTTCCTCTCCTCGCCCGCCGACGACGACTGCCCCCTAGGCGGCCAGGCCGCGTAC
GGAGACGCCGTCGTGGTGGACCGGAACGAGGCGGCGGTGCGGGCCAGCCACTTCCGGACGGCCCACACGCCGCTC
CGGAGCCAGGCCGACTTCATCGAGGCCTACGCGGCCGCCAGACGGATCGCCGACGACGTTTCCCGCCAGACGGGC
GCCGACGTGTTCCCCTACAGCGTCTTCTACATCTTCTTCGACCAGTACCTGTCCATGGTGCCCCTCGCGGCCGGT
CTCCTCTCGGCAACGGTGGTCATCATCCTGGCCATGGCCTGTCTGCTGCTCGGCTCCGTCCGGACGTCTGTCGTG
GTGGCGGCGACGGTCGTCATGACAGTCGTCGACATCATGGGCGCCATGGCCCTCATGGGCGTCTCCCTCAACGCC
GTCTCCCTCGTCAACCTCATCATCTGCGTCGGCATCTCGGTCGAGTTCTGCGCTCACGTAGCCCGAGCCTTTACG
TTCCCCTCTCGCACCGTCATGGAAGCCAACAACAACGCCTTCCGCGGCCGCGACGCCCGCGCCTGGACCGCCCTC
GTCAACGTCGGCGGCTCCGTCTTCTCCGGCATCACCATCACCAAGCTCCTCGGCGTCTGCGTCCTGGCCTTTACG
AGCTCCAAGATCTTTGAGGTTTACTACTTCCGCGTCTGGCTCGCTCTCGTCATCTTTGCCGCCCTGCACGCGCTC
GTCTTCCTGCCCGTTGCCCTTGGCTTCGCCGGTGGTCGTGGCTACGTCGATCCCGAGAGCGAGGGGACTGCTGCT
CAGGACCTTACCGATAGGAGGTGGCGGGCTATTCGGGTTCATGACAATAGCGACTCTGATGACGGGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail