Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01374
Gene name
Locationscaffold_01:4833293..4835710
Strand+
Gene length (bp)2417
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10360 DUF2433 Protein of unknown function (DUF2433) 4.1E-49 276 405

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6147 0.4725 0.374 0.1297 0.1156 0.0331 0.246 0.0639 0.1877 0.0105

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2545
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5711
Ophiocordyceps australis map64 (Brazil) OphauB2|870
Ophiocordyceps camponoti-floridani Ophcf2|01374 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2607
Ophiocordyceps kimflemingae Ophio5|5487
Ophiocordyceps subramaniannii Hirsu2|3764

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01374
MAASRPYNNPGYLQNGALPQPGAAPLLPNQGRVIQTGPIRTLCIADVRGNLRSLNELAKQARADHIIHTGDFGFY
DNTSLDRIAEKTLKHVAQYSPLISEPVKKAIQQGGSGPVKSRFSPSELPLSELPLLLTGELKLDVPVYTVWGACE
DVRVLEKFRSSEYKVHNLHIIDEARSMLLEVGGVKLRLLGLGGAVVMHKLFDNGEGRTTIAGGQGTMWTTLLQMG
ELVDTAHRVYDPTETRIFITHASPAREGILNQLSVTLKADFSISAGLHFRYGSSYNEFSVNPTLDHYRGKLAASK
ASFNDVWETVKGEVEPAIQSNEAQQNLLKNALQIVEKMPTTAAGGNPFGGPVAGQAALGQVDESAFKNMWNFNLA
DAAFGYLVLEIQDGRIGTEMRAQGFNFSHRGAKQQTGAAAPPPPADVGGQSSPAPPVAQPAAPAQASRQPPMSQP
PKPAAATRSSGGTKPATPKPAQASDGAGGKDSEKTPAAANGSAHGPELSASPAPKSSSYDIVGLFVMNVGSDDQC
RDMFDEEDKNKIVKLEKWGPANRVVHFKTTEERDAALARLPEDIKTRASDDRSKPLVKLFLPKEGGGGRPYSNRG
GAGNWGGMPAAAAPAAATEAPEAPAIRKATDAAAGVAVGAEEATGPEVVADVALSRPMAAHLRLLHPRPSESRSC
AMDEAGTETFGLPRHPSFLVALILALEQG*
Coding >Ophcf2|01374
ATGGCTGCTTCGCGACCTTACAACAATCCAGGCTATCTCCAAAACGGCGCTCTTCCCCAGCCTGGGGCGGCCCCT
CTTCTCCCGAATCAAGGCCGCGTCATCCAGACAGGTCCTATTAGAACCCTCTGCATTGCAGACGTTCGCGGAAAC
CTGAGATCGCTCAACGAACTCGCCAAGCAGGCTCGCGCCGATCACATCATCCACACTGGTGACTTTGGCTTCTAC
GATAACACTTCGCTGGACAGAATCGCAGAGAAGACGCTCAAGCATGTCGCCCAATACTCTCCCCTCATTTCCGAA
CCCGTCAAAAAGGCCATCCAACAAGGCGGCAGCGGCCCGGTCAAATCTCGCTTCAGCCCCTCCGAGCTTCCTCTG
TCTGAGCTACCGCTCCTGCTCACTGGCGAGCTGAAGCTTGACGTGCCGGTCTACACGGTTTGGGGTGCTTGCGAG
GATGTCCGTGTGCTAGAAAAGTTCAGGTCCTCCGAGTACAAGGTGCACAATCTGCACATCATTGACGAGGCTCGC
TCTATGCTCCTCGAAGTTGGCGGCGTGAAGCTCAGGCTTCTCGGGCTCGGCGGCGCCGTGGTGATGCACAAGCTT
TTCGACAACGGTGAGGGCCGCACCACCATTGCCGGAGGGCAGGGAACAATGTGGACCACGCTGCTGCAGATGGGA
GAGCTCGTCGACACGGCTCATCGGGTATACGACCCCACCGAGACGCGCATCTTCATCACACATGCATCTCCTGCC
CGTGAGGGAATCTTGAACCAGCTCTCCGTTACGCTCAAGGCAGACTTTTCCATTTCGGCCGGTCTTCACTTTCGC
TACGGAAGCTCCTATAACGAGTTTAGCGTCAATCCGACTCTCGATCATTACCGAGGAAAGCTGGCTGCCTCCAAG
GCCTCTTTCAACGACGTGTGGGAGACGGTCAAGGGCGAGGTCGAGCCTGCCATTCAGTCTAACGAAGCGCAGCAA
AACCTCCTCAAGAATGCCCTCCAAATCGTCGAAAAGATGCCGACAACGGCGGCCGGCGGGAACCCTTTCGGGGGT
CCTGTGGCTGGCCAAGCCGCTCTTGGTCAAGTCGACGAGAGTGCCTTCAAGAACATGTGGAACTTCAATCTCGCC
GACGCCGCGTTTGGCTATCTGGTTCTGGAAATCCAGGACGGTCGCATCGGCACCGAGATGCGCGCCCAAGGCTTC
AACTTTTCGCACCGCGGAGCCAAGCAACAAACCGGAGCGGCTGCCCCCCCGCCGCCGGCCGACGTCGGAGGCCAG
TCCTCGCCGGCGCCCCCCGTTGCGCAGCCCGCGGCGCCCGCACAAGCCAGCCGGCAGCCGCCTATGTCTCAGCCA
CCCAAACCGGCTGCTGCCACGCGGTCGTCTGGAGGGACAAAGCCAGCTACCCCCAAGCCTGCCCAGGCCTCCGAT
GGTGCCGGTGGCAAAGACTCCGAAAAGACGCCAGCGGCGGCCAACGGCTCGGCCCATGGTCCCGAGCTCAGCGCT
TCTCCTGCGCCCAAGTCTTCTTCTTACGATATCGTTGGCCTTTTCGTCATGAACGTCGGCAGCGATGATCAATGT
CGCGACATGTTTGACGAAGAGGACAAGAACAAGATCGTCAAGTTGGAGAAATGGGGGCCGGCGAACAGGGTGGTG
CACTTCAAGACAACCGAAGAGCGAGATGCAGCCTTGGCGCGACTTCCGGAAGACATCAAAACGCGGGCTTCGGAT
GACCGATCCAAGCCGCTGGTCAAGTTGTTTTTGCCGAAAGAGGGCGGCGGCGGCAGGCCCTACAGCAACCGCGGC
GGGGCGGGCAACTGGGGGGGAATGCCCGCGGCGGCGGCTCCGGCAGCGGCTACCGAAGCGCCGGAGGCACCAGCG
ATTCGGAAAGCAACCGACGCGGCGGCCGGGGTGGCCGTGGGGGCCGAGGAGGCGACAGGTCCCGAAGTGGTCGCG
GACGTGGCGTTATCAAGGCCGATGGCGGCACATCTTCGCCTTCTACACCCGCGGCCGAGTGAGTCGAGGTCATGT
GCCATGGACGAGGCGGGCACTGAAACATTTGGCTTGCCACGCCATCCTTCTTTTCTCGTCGCATTGATTCTAGCT
CTGGAGCAAGGTTGA
Transcript >Ophcf2|01374
ATGGCTGCTTCGCGACCTTACAACAATCCAGGCTATCTCCAAAACGGCGCTCTTCCCCAGCCTGGGGCGGCCCCT
CTTCTCCCGAATCAAGGCCGCGTCATCCAGACAGGTCCTATTAGAACCCTCTGCATTGCAGACGTTCGCGGAAAC
CTGAGATCGCTCAACGAACTCGCCAAGCAGGCTCGCGCCGATCACATCATCCACACTGGTGACTTTGGCTTCTAC
GATAACACTTCGCTGGACAGAATCGCAGAGAAGACGCTCAAGCATGTCGCCCAATACTCTCCCCTCATTTCCGAA
CCCGTCAAAAAGGCCATCCAACAAGGCGGCAGCGGCCCGGTCAAATCTCGCTTCAGCCCCTCCGAGCTTCCTCTG
TCTGAGCTACCGCTCCTGCTCACTGGCGAGCTGAAGCTTGACGTGCCGGTCTACACGGTTTGGGGTGCTTGCGAG
GATGTCCGTGTGCTAGAAAAGTTCAGGTCCTCCGAGTACAAGGTGCACAATCTGCACATCATTGACGAGGCTCGC
TCTATGCTCCTCGAAGTTGGCGGCGTGAAGCTCAGGCTTCTCGGGCTCGGCGGCGCCGTGGTGATGCACAAGCTT
TTCGACAACGGTGAGGGCCGCACCACCATTGCCGGAGGGCAGGGAACAATGTGGACCACGCTGCTGCAGATGGGA
GAGCTCGTCGACACGGCTCATCGGGTATACGACCCCACCGAGACGCGCATCTTCATCACACATGCATCTCCTGCC
CGTGAGGGAATCTTGAACCAGCTCTCCGTTACGCTCAAGGCAGACTTTTCCATTTCGGCCGGTCTTCACTTTCGC
TACGGAAGCTCCTATAACGAGTTTAGCGTCAATCCGACTCTCGATCATTACCGAGGAAAGCTGGCTGCCTCCAAG
GCCTCTTTCAACGACGTGTGGGAGACGGTCAAGGGCGAGGTCGAGCCTGCCATTCAGTCTAACGAAGCGCAGCAA
AACCTCCTCAAGAATGCCCTCCAAATCGTCGAAAAGATGCCGACAACGGCGGCCGGCGGGAACCCTTTCGGGGGT
CCTGTGGCTGGCCAAGCCGCTCTTGGTCAAGTCGACGAGAGTGCCTTCAAGAACATGTGGAACTTCAATCTCGCC
GACGCCGCGTTTGGCTATCTGGTTCTGGAAATCCAGGACGGTCGCATCGGCACCGAGATGCGCGCCCAAGGCTTC
AACTTTTCGCACCGCGGAGCCAAGCAACAAACCGGAGCGGCTGCCCCCCCGCCGCCGGCCGACGTCGGAGGCCAG
TCCTCGCCGGCGCCCCCCGTTGCGCAGCCCGCGGCGCCCGCACAAGCCAGCCGGCAGCCGCCTATGTCTCAGCCA
CCCAAACCGGCTGCTGCCACGCGGTCGTCTGGAGGGACAAAGCCAGCTACCCCCAAGCCTGCCCAGGCCTCCGAT
GGTGCCGGTGGCAAAGACTCCGAAAAGACGCCAGCGGCGGCCAACGGCTCGGCCCATGGTCCCGAGCTCAGCGCT
TCTCCTGCGCCCAAGTCTTCTTCTTACGATATCGTTGGCCTTTTCGTCATGAACGTCGGCAGCGATGATCAATGT
CGCGACATGTTTGACGAAGAGGACAAGAACAAGATCGTCAAGTTGGAGAAATGGGGGCCGGCGAACAGGGTGGTG
CACTTCAAGACAACCGAAGAGCGAGATGCAGCCTTGGCGCGACTTCCGGAAGACATCAAAACGCGGGCTTCGGAT
GACCGATCCAAGCCGCTGGTCAAGTTGTTTTTGCCGAAAGAGGGCGGCGGCGGCAGGCCCTACAGCAACCGCGGC
GGGGCGGGCAACTGGGGGGGAATGCCCGCGGCGGCGGCTCCGGCAGCGGCTACCGAAGCGCCGGAGGCACCAGCG
ATTCGGAAAGCAACCGACGCGGCGGCCGGGGTGGCCGTGGGGGCCGAGGAGGCGACAGGTCCCGAAGTGGTCGCG
GACGTGGCGTTATCAAGGCCGATGGCGGCACATCTTCGCCTTCTACACCCGCGGCCGAGTGAGTCGAGGTCATGT
GCCATGGACGAGGCGGGCACTGAAACATTTGGCTTGCCACGCCATCCTTCTTTTCTCGTCGCATTGATTCTAGCT
CTGGAGCAAGGTTGA
Gene >Ophcf2|01374
ATGGCTGCTGTGAGTCCATCTCCTCTGACTTTTGCCCGCATCTCCCATCGAATCCCTGCCCATTTCGAGAAGCTA
TGTGTACTCTCGTCGGCTTCAGGCCTGAGCTGCTGTCGCATGCCACGGTCAACAAACTACTCTCCTTTCGAACCT
CAGCTGCCTGGATGGCGGCGCTGTTTGCACACAACTTCCCCCTTCCTACTTCCCGCGCTCGCCGGCTCTTTCGCC
GTATATGAAATTTCAGGATGCTGACTCTGGACAGTCGCGACCTTACAACAATCCAGGCTATCTCCAAAACGGCGC
TCTTCCCCAGCCTGGGGCGGCCCCTCTTCTCCCGAATCAAGGCCGCGTCATCCAGACAGGTCCTATTAGAACCCT
CTGCATTGCAGACGTTCGCGGTCAGTGGTTCTCGATTCTGGCCTCTAGACGACAAGCTGATGCTCGATGCAGGAA
ACCTGAGATCGCTCAACGAACTCGCCAAGCAGGCTCGCGCCGATCACATCATCCACACTGGTGACTTTGGCTTCT
ACGATAACACTTCGCTGGACAGAATCGCAGAGAAGACGCTCAAGCATGTCGCCCAATACTCTCCCCTCATTTCCG
AACCCGTCAAAAAGGCCATCCAACAAGGCGGCAGCGGCCCGGTCAAATCTCGCTTCAGCCCCTCCGAGCTTCCTC
TGTCTGAGCTACCGCTCCTGCTCACTGGCGAGCTGAAGCTTGACGTGCCGGTCTACACGGTTTGGGGTGCTTGCG
AGGATGTCCGTGTGCTAGAAAAGTTCAGGTCCTCCGAGTACAAGGTGCACAATCTGCACATCATTGACGAGGCTC
GCTCTATGCTCCTCGAAGTTGGCGGCGTGAAGCTCAGGCTTCTCGGGCTCGGCGGCGCCGTGGTGATGCACAAGC
TTTTCGACAACGGTGAGGGCCGCACCACCATTGCCGGAGGGCAGGGAACAATGTGGACCACGCTGCTGCAGATGG
GAGAGCTCGTCGACACGGCTCATCGGGTATACGACCCCACCGAGACGCGCATCTTCATCACACATGCATCTCCTG
CCCGTGAGGGAATCTTGAACCAGCTCTCCGTTACGCTCAAGGCAGACTTTTCCATTTCGGCCGGTCTTCACTTTC
GCTACGGAAGCTCCTATAACGAGTTTAGCGTCAATCCGACTCTCGATCATTACCGAGGAAAGCTGGCTGCCTCCA
AGGCCTCTTTCAACGACGTGTGGGAGACGGTCAAGGGCGAGGTCGAGCCTGCCATTCAGTCTAACGAAGCGCAGC
AAAACCTCCTCAAGAATGCCCTCCAAATCGTCGAAAAGATGCCGACAACGGCGGCCGGCGGGAACCCTTTCGGGG
GTCCTGTGGCTGGCCAAGCCGCTCTTGGTCAAGTCGACGAGAGTGCCTTCAAGAACATGTGGAACTTCAATCTCG
CCGACGCCGCGTTTGGCTATCTGGTTCTGGAAATCCAGGACGGTCGCATCGGCACCGAGATGCGCGCCCAAGGCT
TCAACTTTTCGCACCGCGGAGCCAAGCAACAAACCGGAGCGGCTGCCCCCCCGCCGCCGGCCGACGTCGGAGGCC
AGTCCTCGCCGGCGCCCCCCGTTGCGCAGCCCGCGGCGCCCGCACAAGCCAGCCGGCAGCCGCCTATGTCTCAGC
CACCCAAACCGGCTGCTGCCACGCGGTCGTCTGGAGGGACAAAGCCAGCTACCCCCAAGCCTGCCCAGGCCTCCG
ATGGTGCCGGTGGCAAAGACTCCGAAAAGACGCCAGCGGCGGCCAACGGCTCGGCCCATGGTCCCGAGCTCAGCG
CTTCTCCTGCGCCCAAGTCTTCTTCTTACGATATCGTTGGCCTTTTCGTCATGAACGTCGGCAGCGATGATCAAT
GTCGCGACATGTTTGACGAAGAGGACAAGAACAAGATCGTCAAGTTGGAGAAATGGGGGCCGGCGAACAGGGTGG
TGCACTTCAAGACAACCGAAGAGCGAGATGCAGCCTTGGCGCGACTTCCGGAAGACATCAAAACGCGGGCTTCGG
ATGACCGATCCAAGCCGCTGGTCAAGTTGTTTTTGCCGAAAGAGGGCGGCGGCGGCAGGCCCTACAGCAACCGCG
GCGGGGCGGGCAACTGGGGGGGAATGCCCGCGGCGGCGGCTCCGGCAGCGGCTACCGAAGCGCCGGAGGCACCAG
CGATTCGGAAAGCAACCGACGCGGCGGCCGGGGTGGCCGTGGGGGCCGAGGAGGCGACAGGTCCCGAAGTGGTCG
CGGACGTGGCGTTATCAAGGCCGATGGCGGCACATCTTCGCCTTCTACACCCGCGGCCGAGTGAGTCGAGGTCAT
GTGCCATGGACGAGGCGGGCACTGAAACATTTGGCTTGCCACGCCATCCTTCTTTTCTCGTCGCATTGATTCTAG
CTCTGGAGCAAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail