Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01373
Gene name
Locationscaffold_01:4829139..4831967
Strand-
Gene length (bp)2828
Transcript length (bp)2703
Coding sequence length (bp)2703
Protein length (aa) 901

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08632 Zds_C Activator of mitotic machinery Cdc14 phosphatase activation C-term 1.9E-28 734 784

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6557 0.2669 0.0499 0.3127 0.0885 0.0269 0.17 0.3919 0.1703 0.0264

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2544
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5710
Ophiocordyceps australis map64 (Brazil) OphauB2|869
Ophiocordyceps camponoti-floridani Ophcf2|01373 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2608
Ophiocordyceps kimflemingae Ophio5|5486
Ophiocordyceps subramaniannii Hirsu2|3762

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01373
MMTSSRPRDDISGTRRGHASQLSISDPSHHVTEAIGTLYGDEDDSGSEGGRPMSFISGSPYNEELHRMSPPELHE
RPPNHQHASEKSTSYPPHNQPSDSSTSTQAEHGSLRKLQTFVSTSPSQRSNNSYELSSQSPVSPTPSLRDVQADS
TGSQFPLTNIDNPSDIAQELSNLQALRRLSMDVGNNIDPDMPPMGFSAMPPVAPSGNDDENDPSRLLWVPARVHP
ELAPTEFKTFLEKRVQSIRRRSGDPLLAADFEAGLGRSESLLRRNKSTLSRQIDNTGGRGAVGYVDGSERLERQR
SSSGSQHGPELSLDELVKDPTKAVQRLAQETQSASLGAEGGGDDMPILPMAPGVGLRRSTRTTYRKGGSLRSRDR
GSFSRRLPQRQSEGDYTDLNSTAASEVVVKGPMTAEASTESAADMHSQPVRSGRRPRNLSQETTPVMAGADGPSE
VNMESRPPPRAQRPRVRTPSDSGEEPFPPSERSERSDSPVVRSFPQRSSSQNAMPPHDHHPEASEDATSRPSRRP
TIGNSTKLPAQSQYITKSPNSMHLHTMGDSLASPSSLIGADASRTDSLTFIPTLSQPEKKPEKKSSKKDKDEDSS
STSSRSGSAWKWFKGVTDDRDRKKEEGRKSKTRASAERTQDNVRLDVIQTSIDRSNVKGRESLVLDRDNVDSKLL
EERKKESNRKSDSKKEKDGSIFSSIFGGSKKKEEKEKVNKKSQQYLQVPEDVSFKPLTPDVDYNWSRFPLLEERA
IYRMAHIKLANPRRSLLSQVLLSNFMYSYLAIVQTMHPQMNVPTSPQQKRLEEEARRKRREEEYLARQGEHASDN
GLDLYNFDYHRAAVQYADSGAEGQADYVDEAQIYEDEHGDDDEYGYEGVDGSGREAKEYLHEEDDHRRHRQDDMW
*
Coding >Ophcf2|01373
ATGATGACCTCATCTAGGCCGCGTGACGATATTTCTGGCACCCGGCGTGGCCATGCCAGCCAGCTCTCCATCTCT
GATCCGAGCCACCATGTAACTGAAGCCATAGGCACTCTCTACGGCGACGAGGATGACTCTGGCTCAGAGGGTGGC
CGGCCCATGAGCTTCATCAGCGGATCTCCATACAATGAAGAGTTGCATCGGATGTCACCGCCCGAGCTGCATGAA
CGGCCGCCCAATCATCAGCATGCAAGCGAAAAGTCGACATCGTATCCTCCCCACAACCAGCCGTCGGACTCGTCG
ACGTCCACCCAGGCTGAGCATGGCAGCCTCAGGAAGCTACAAACTTTTGTCTCGACGTCGCCATCTCAGCGAAGT
AACAACTCGTACGAACTCAGCTCCCAATCGCCTGTTTCACCGACGCCTTCGCTTCGAGATGTCCAGGCAGATTCG
ACCGGATCTCAATTTCCATTGACCAACATAGATAATCCAAGCGATATTGCTCAGGAGTTGAGCAACCTGCAGGCT
CTCAGGAGACTTTCCATGGACGTGGGAAACAACATCGACCCGGACATGCCTCCTATGGGCTTTTCGGCCATGCCC
CCAGTGGCTCCCAGCGGGAATGATGACGAGAACGATCCATCCAGGCTCCTTTGGGTCCCGGCCAGGGTCCATCCG
GAACTAGCTCCGACAGAGTTCAAGACTTTTCTGGAGAAACGCGTCCAGTCCATCCGGAGGAGGTCGGGGGATCCC
CTACTCGCCGCGGACTTCGAGGCGGGCCTCGGCCGTTCCGAATCGCTGTTGAGGAGGAACAAGTCAACACTCTCA
CGGCAAATTGACAACACTGGAGGCCGTGGAGCAGTTGGCTATGTGGACGGTTCTGAGCGTCTCGAGCGACAGAGG
TCGTCAAGCGGCAGCCAGCACGGCCCCGAGCTCAGTCTCGACGAATTGGTCAAGGATCCAACGAAAGCGGTGCAG
AGACTCGCACAGGAGACTCAGAGTGCTTCGTTGGGCGCTGAAGGCGGTGGTGACGACATGCCCATCCTTCCTATG
GCTCCGGGGGTAGGATTGCGCCGATCAACCCGCACCACGTATCGCAAGGGTGGAAGTTTGCGATCTCGAGACCGG
GGATCCTTCTCGAGGCGTCTCCCTCAGCGACAGTCCGAAGGTGACTATACCGACTTGAACAGCACGGCTGCATCA
GAAGTGGTCGTCAAGGGACCTATGACGGCAGAGGCTTCAACAGAGTCGGCTGCAGACATGCACTCCCAACCCGTG
CGATCCGGACGGCGCCCCAGAAACTTGTCGCAAGAAACAACTCCTGTCATGGCTGGCGCCGACGGCCCCTCTGAG
GTAAACATGGAGTCTCGCCCGCCGCCTCGGGCCCAGCGGCCTCGGGTTCGGACACCCTCGGATTCTGGGGAAGAG
CCATTTCCCCCATCAGAGCGGTCAGAACGATCAGACAGCCCAGTGGTAAGATCGTTTCCCCAGAGGTCGTCGTCG
CAAAACGCAATGCCACCTCACGATCATCACCCCGAAGCCTCCGAGGATGCTACTAGTCGCCCGAGCAGACGTCCA
ACGATTGGCAACAGCACGAAGCTGCCAGCGCAGTCTCAATATATCACAAAATCGCCAAACTCGATGCATTTGCAC
ACCATGGGCGACTCGCTGGCCTCCCCCTCCTCCCTCATTGGCGCGGACGCCTCTCGTACCGACAGTCTGACATTT
ATTCCCACGTTGAGCCAACCCGAGAAGAAGCCGGAAAAGAAATCATCGAAAAAAGATAAAGATGAAGACTCATCT
AGCACTTCGAGCAGGTCAGGCAGCGCATGGAAATGGTTCAAGGGTGTCACGGACGACAGAGATCGGAAGAAGGAA
GAGGGAAGGAAGTCCAAGACGCGAGCCAGCGCCGAGAGGACTCAAGACAACGTGCGGCTAGATGTGATCCAAACA
TCCATCGACAGAAGTAACGTCAAGGGTCGCGAAAGCCTTGTTCTGGATCGCGACAACGTCGACAGCAAGCTTCTG
GAAGAGAGGAAGAAGGAGAGTAATCGCAAGAGCGACTCGAAAAAGGAGAAGGACGGTAGCATCTTCTCCTCCATC
TTCGGGGGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTAACAAGAAGAGCCAGCAGTACTTGCAGGTGCCTGAA
GACGTTTCCTTCAAGCCTTTGACTCCAGACGTGGACTACAACTGGTCAAGGTTCCCGCTCCTCGAAGAGAGGGCC
ATCTATCGCATGGCGCACATCAAGCTAGCCAACCCGCGCCGCTCCCTCCTCAGCCAGGTGCTTCTCAGCAACTTC
ATGTACAGCTACCTGGCGATTGTGCAGACTATGCACCCCCAGATGAACGTGCCGACCTCGCCGCAGCAGAAGCGA
CTGGAGGAGGAAGCCAGGCGCAAAAGGCGTGAGGAAGAGTACCTGGCGAGGCAGGGCGAGCATGCTTCCGATAAC
GGCCTCGACCTGTATAACTTTGACTATCACAGGGCCGCTGTTCAGTATGCCGATTCGGGAGCAGAAGGACAGGCT
GATTATGTCGACGAAGCCCAGATATACGAAGATGAGCATGGGGACGACGACGAATACGGCTACGAAGGTGTCGAT
GGCTCCGGTCGCGAAGCCAAGGAGTATCTTCACGAGGAAGACGATCATCGACGGCACCGGCAAGACGACATGTGG
TAA
Transcript >Ophcf2|01373
ATGATGACCTCATCTAGGCCGCGTGACGATATTTCTGGCACCCGGCGTGGCCATGCCAGCCAGCTCTCCATCTCT
GATCCGAGCCACCATGTAACTGAAGCCATAGGCACTCTCTACGGCGACGAGGATGACTCTGGCTCAGAGGGTGGC
CGGCCCATGAGCTTCATCAGCGGATCTCCATACAATGAAGAGTTGCATCGGATGTCACCGCCCGAGCTGCATGAA
CGGCCGCCCAATCATCAGCATGCAAGCGAAAAGTCGACATCGTATCCTCCCCACAACCAGCCGTCGGACTCGTCG
ACGTCCACCCAGGCTGAGCATGGCAGCCTCAGGAAGCTACAAACTTTTGTCTCGACGTCGCCATCTCAGCGAAGT
AACAACTCGTACGAACTCAGCTCCCAATCGCCTGTTTCACCGACGCCTTCGCTTCGAGATGTCCAGGCAGATTCG
ACCGGATCTCAATTTCCATTGACCAACATAGATAATCCAAGCGATATTGCTCAGGAGTTGAGCAACCTGCAGGCT
CTCAGGAGACTTTCCATGGACGTGGGAAACAACATCGACCCGGACATGCCTCCTATGGGCTTTTCGGCCATGCCC
CCAGTGGCTCCCAGCGGGAATGATGACGAGAACGATCCATCCAGGCTCCTTTGGGTCCCGGCCAGGGTCCATCCG
GAACTAGCTCCGACAGAGTTCAAGACTTTTCTGGAGAAACGCGTCCAGTCCATCCGGAGGAGGTCGGGGGATCCC
CTACTCGCCGCGGACTTCGAGGCGGGCCTCGGCCGTTCCGAATCGCTGTTGAGGAGGAACAAGTCAACACTCTCA
CGGCAAATTGACAACACTGGAGGCCGTGGAGCAGTTGGCTATGTGGACGGTTCTGAGCGTCTCGAGCGACAGAGG
TCGTCAAGCGGCAGCCAGCACGGCCCCGAGCTCAGTCTCGACGAATTGGTCAAGGATCCAACGAAAGCGGTGCAG
AGACTCGCACAGGAGACTCAGAGTGCTTCGTTGGGCGCTGAAGGCGGTGGTGACGACATGCCCATCCTTCCTATG
GCTCCGGGGGTAGGATTGCGCCGATCAACCCGCACCACGTATCGCAAGGGTGGAAGTTTGCGATCTCGAGACCGG
GGATCCTTCTCGAGGCGTCTCCCTCAGCGACAGTCCGAAGGTGACTATACCGACTTGAACAGCACGGCTGCATCA
GAAGTGGTCGTCAAGGGACCTATGACGGCAGAGGCTTCAACAGAGTCGGCTGCAGACATGCACTCCCAACCCGTG
CGATCCGGACGGCGCCCCAGAAACTTGTCGCAAGAAACAACTCCTGTCATGGCTGGCGCCGACGGCCCCTCTGAG
GTAAACATGGAGTCTCGCCCGCCGCCTCGGGCCCAGCGGCCTCGGGTTCGGACACCCTCGGATTCTGGGGAAGAG
CCATTTCCCCCATCAGAGCGGTCAGAACGATCAGACAGCCCAGTGGTAAGATCGTTTCCCCAGAGGTCGTCGTCG
CAAAACGCAATGCCACCTCACGATCATCACCCCGAAGCCTCCGAGGATGCTACTAGTCGCCCGAGCAGACGTCCA
ACGATTGGCAACAGCACGAAGCTGCCAGCGCAGTCTCAATATATCACAAAATCGCCAAACTCGATGCATTTGCAC
ACCATGGGCGACTCGCTGGCCTCCCCCTCCTCCCTCATTGGCGCGGACGCCTCTCGTACCGACAGTCTGACATTT
ATTCCCACGTTGAGCCAACCCGAGAAGAAGCCGGAAAAGAAATCATCGAAAAAAGATAAAGATGAAGACTCATCT
AGCACTTCGAGCAGGTCAGGCAGCGCATGGAAATGGTTCAAGGGTGTCACGGACGACAGAGATCGGAAGAAGGAA
GAGGGAAGGAAGTCCAAGACGCGAGCCAGCGCCGAGAGGACTCAAGACAACGTGCGGCTAGATGTGATCCAAACA
TCCATCGACAGAAGTAACGTCAAGGGTCGCGAAAGCCTTGTTCTGGATCGCGACAACGTCGACAGCAAGCTTCTG
GAAGAGAGGAAGAAGGAGAGTAATCGCAAGAGCGACTCGAAAAAGGAGAAGGACGGTAGCATCTTCTCCTCCATC
TTCGGGGGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTAACAAGAAGAGCCAGCAGTACTTGCAGGTGCCTGAA
GACGTTTCCTTCAAGCCTTTGACTCCAGACGTGGACTACAACTGGTCAAGGTTCCCGCTCCTCGAAGAGAGGGCC
ATCTATCGCATGGCGCACATCAAGCTAGCCAACCCGCGCCGCTCCCTCCTCAGCCAGGTGCTTCTCAGCAACTTC
ATGTACAGCTACCTGGCGATTGTGCAGACTATGCACCCCCAGATGAACGTGCCGACCTCGCCGCAGCAGAAGCGA
CTGGAGGAGGAAGCCAGGCGCAAAAGGCGTGAGGAAGAGTACCTGGCGAGGCAGGGCGAGCATGCTTCCGATAAC
GGCCTCGACCTGTATAACTTTGACTATCACAGGGCCGCTGTTCAGTATGCCGATTCGGGAGCAGAAGGACAGGCT
GATTATGTCGACGAAGCCCAGATATACGAAGATGAGCATGGGGACGACGACGAATACGGCTACGAAGGTGTCGAT
GGCTCCGGTCGCGAAGCCAAGGAGTATCTTCACGAGGAAGACGATCATCGACGGCACCGGCAAGACGACATGTGG
TAA
Gene >Ophcf2|01373
ATGATGGTGCGTCGTCTCTAATTGTCGTCTGCTCGATTAGTAGACCATGATTATACTGACTGCCTATTGCATAAG
ACCTCATCTAGGCCGCGTGACGATATTTCTGGCACCCGGCGTGGCCATGCCAGCCAGCTCTCCATCTCTGATCCG
AGCCACCATGTAACTGAAGCCATAGGCACTCTCTACGGCGACGAGGATGACTCTGGCTCAGAGGGTGGCCGGCCC
ATGAGCTTCATCAGCGGATCTCCATACAATGAAGAGTTGCATCGGATGTCACCGCCCGAGCTGCATGAACGGCCG
CCCAATCATCAGCATGCAAGCGAAAAGTCGACATCGTATCCTCCCCACAACCAGCCGTCGGACTCGTCGACGTCC
ACCCAGGCTGAGCATGGCAGCCTCAGGAAGCTACAAACTTTTGTCTCGACGTCGCCATCTCAGCGAAGTAACAAC
TCGTACGAACTCAGCTCCCAATCGCCTGTTTCACCGACGCCTTCGCTTCGAGATGTCCAGGCAGATTCGACCGGA
TCTCAATTTCCATTGACCAACATAGATAATCCAAGCGATATTGCTCAGGAGTTGAGCAACCTGCAGGCTCTCAGG
AGACTTTCCATGGACGTGGGAAACAACATCGACCCGGACATGCCTCCTATGGGCTTTTCGGCCATGCCCCCAGTG
GCTCCCAGCGGGAATGATGACGAGAACGATCCATCCAGGCTCCTTTGGGTCCCGGCCAGGGTCCATCCGGAACTA
GCTCCGACAGAGTTCAAGACTTTTCTGGAGAAACGCGTCCAGTCCATCCGGAGGAGGTCGGGGGATCCCCTACTC
GCCGCGGACTTCGAGGCGGGCCTCGGCCGTTCCGAATCGCTGTTGAGGAGGAACAAGTCAACACTCTCACGGCAA
ATTGACAACACTGGAGGCCGTGGAGCAGTTGGCTATGTGGACGGTTCTGAGCGTCTCGAGCGACAGAGGTCGTCA
AGCGGCAGCCAGCACGGCCCCGAGCTCAGTCTCGACGAATTGGTCAAGGATCCAACGAAAGCGGTGCAGAGACTC
GCACAGGAGACTCAGAGTGCTTCGTTGGGCGCTGAAGGCGGTGGTGACGACATGCCCATCCTTCCTATGGCTCCG
GGGGTAGGATTGCGCCGATCAACCCGCACCACGTATCGCAAGGGTGGAAGTTTGCGATCTCGAGACCGGGGATCC
TTCTCGAGGCGTCTCCCTCAGCGACAGTCCGAAGGTGACTATACCGACTTGAACAGCACGGCTGCATCAGAAGTG
GTCGTCAAGGGACCTATGACGGCAGAGGCTTCAACAGAGTCGGCTGCAGACATGCACTCCCAACCCGTGCGATCC
GGACGGCGCCCCAGAAACTTGTCGCAAGAAACAACTCCTGTCATGGCTGGCGCCGACGGCCCCTCTGAGGTAAAC
ATGGAGTCTCGCCCGCCGCCTCGGGCCCAGCGGCCTCGGGTTCGGACACCCTCGGATTCTGGGGAAGAGCCATTT
CCCCCATCAGAGCGGTCAGAACGATCAGACAGCCCAGTGGTAAGATCGTTTCCCCAGAGGTCGTCGTCGCAAAAC
GCAATGCCACCTCACGATCATCACCCCGAAGCCTCCGAGGATGCTACTAGTCGCCCGAGCAGACGTCCAACGATT
GGCAACAGCACGAAGCTGCCAGCGCAGTCTCAATATATCACAAAATCGCCAAACTCGATGCATTTGCACACCATG
GGCGACTCGCTGGCCTCCCCCTCCTCCCTCATTGGCGCGGACGCCTCTCGTACCGACAGTCTGACATTTATTCCC
ACGTTGAGCCAACCCGAGAAGAAGCCGGAAAAGAAATCATCGAAAAAAGATAAAGATGAAGACTCATCTAGCACT
TCGAGCAGGTCAGGCAGCGCATGGAAATGGTTCAAGGGTGTCACGGACGACAGAGATCGGAAGAAGGAAGAGGGA
AGGAAGTCCAAGACGCGAGCCAGCGCCGAGAGGACTCAAGACAACGTGCGGCTAGATGTGATCCAAACATCCATC
GACAGAAGTAACGTCAAGGGTCGCGAAAGCCTTGTTCTGGATCGCGACAACGTCGACAGCAAGCTTCTGGAAGAG
AGGAAGAAGGAGAGTAATCGCAAGAGCGACTCGAAAAAGGAGAAGGACGGTAGCATCTTCTCCTCCATCTTCGGG
GGAAGCAAGAAGAAGGAAGAGAAGGAAAAGGTTAACAAGAAGAGCCAGCAGTACTTGCAGGTGCCTGAAGACGTT
TCCTTCAAGCCTTTGACTCCAGACGTGGACTACAACTGGTCAAGGTTCCCGCTCCTCGAAGAGAGGGCCATCTAT
CGCATGGCGCACATCAAGCTAGCCAACCCGCGCCGCTCCCTCCTCAGCCAGGTGCTTCTCAGCAACTTCATGTAC
AGCTACCTGGCGATTGTGCAGACTATGCACCCCCAGATGAACGTGCCGACCTCGCCGCAGCAGAAGCGACTGGAG
GAGGAAGCCAGGCGCAAAAGGCGTGAGGAAGAGTACCTGGCGAGGCAGGGCGAGCATGCTTCCGATAACGGCCTC
GACCTGTATAACTTTGACTATCACAGGGTAGGTCTCCGCTGCATGGATTTCCTCTGCACCGGATTTTGCTGACGG
CCCTGGAGGCCGCTGTTCAGTATGCCGATTCGGGAGCAGAAGGACAGGCTGATTATGTCGACGAAGCCCAGATAT
ACGAAGATGAGCATGGGGACGACGACGAATACGGCTACGAAGGTGTCGATGGCTCCGGTCGCGAAGCCAAGGAGT
ATCTTCACGAGGAAGACGATCATCGACGGCACCGGCAAGACGACATGTGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail