Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01369
Gene name
Locationscaffold_01:4819205..4821512
Strand+
Gene length (bp)2307
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07885 Ion_trans_2 Ion channel 9.4E-16 216 288
PF07885 Ion_trans_2 Ion channel 2.1E-17 375 452

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane|Lysosome/Vacuole Transmembrane domain 0.1155 0.0619 0.0202 0.7639 0.1588 0.0203 0.3027 0.6404 0.2041 0.0197

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 95 117 22
2 130 152 22
3 167 189 22
4 210 229 19
5 265 287 22
6 367 389 22
7 399 421 22
8 428 445 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 27.62 15.36 39.89
Alive In ants, during behavior modification 41.06 23.19 58.94
Dead In ants, recently dead 37.99 21.72 54.27

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.037049 yes
Alive Dead 0.690794 no
Dead Fungus 0.097555 no

Orthologs

Orthofinder run ID4
Orthogroup6326
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01369 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2570
Ophiocordyceps kimflemingae Ophio5|5483
Ophiocordyceps subramaniannii Hirsu2|9819

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01369
MVDSPLIDASDPLARVATSLLRPEFPLEARFQNDDSHLVPSRLWFASSAFPMVAGTLGPVASAFSICALVRQWRQ
HVPPETDLDAATFVPDPPWLLIINAIQLAVALVANIMLLLNMAKRVRFTIAQPITIVGWYISSILLIACTATASG
PLRRSLDPPDEYVWSQAFYYGIWAAILYFIVASLMAVTFCGAWSGHYDKDFNLTNSQRTLMLQTIAVLAYLLIGA
LIFSKIEDWPYLDAVYWADVTLFTIGFGDFAPKTQLGRGLLIPYALVGIISVGLVISSISSLMLERGSRRLDARM
EEKRRRKVITAMTRKGEDDILTPLPPGPISNMRVSDDPLADEFDRRRCEFDLMRMIQKTASSRRRWLAMALSFSI
WVVLWLVGAAVFYACEWSYQHWTYFEAFYYCFISLLTIGYGDLHVVSNAGRSFFVFWSLMALPTMTVLISNAGDT
VVKLINDYTNYLGNLTILPGDEPLGHTLKRIVHTISCGRLFPSVNRAGPDAEGLERLNEKTDQPWGDVQATVKTS
ASPSLSRALSVMRSSAGVLLPTNTAASGSLSRAMTAVQNTTGVLIPTNTAERQSLNRVHDILGALPTGNDFNLLL
ITEIQSVAKHLREDEPRRYSFEEWAWYLGLIGEDERKPEMHRKAIPKEERKHPRHRHHPHKHRHARRHHHSQRET
HAPAASSSAPAAAVVDDDDGVEDDLLKWSWVGKYSPLVGGQEESEWILERLMMSLHESLWKTRVAHDEGLSETAA
SV*
Coding >Ophcf2|01369
ATGGTTGATAGTCCGCTCATCGACGCCTCTGATCCCCTGGCCCGTGTCGCCACGTCTCTTCTGCGGCCTGAGTTT
CCTCTGGAGGCTCGCTTTCAGAATGACGACTCCCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGTTGCCGGCACCTTGGGACCAGTCGCCTCGGCCTTCAGCATCTGCGCCCTTGTGCGTCAATGGCGACAG
CATGTCCCGCCCGAGACCGACCTCGACGCCGCAACCTTTGTGCCCGACCCTCCCTGGCTTCTCATCATCAACGCC
ATCCAGCTGGCCGTTGCCCTAGTCGCCAACATCATGCTCCTACTCAACATGGCCAAGAGGGTGCGCTTCACCATT
GCGCAGCCCATTACAATTGTCGGCTGGTACATCTCTTCTATCCTCCTCATAGCCTGTACCGCGACCGCCAGCGGC
CCCCTGAGACGTAGCCTCGACCCTCCCGACGAATACGTCTGGTCCCAGGCCTTTTACTACGGCATCTGGGCCGCC
ATTCTTTACTTCATCGTCGCCTCCCTCATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGAC
TTTAACCTGACCAACAGCCAGCGCACCCTCATGTTGCAGACCATTGCCGTCCTGGCCTACCTGCTCATCGGCGCC
CTCATCTTCTCCAAGATCGAGGACTGGCCCTACCTCGATGCTGTCTACTGGGCCGACGTGACGCTCTTCACCATC
GGCTTCGGAGACTTTGCGCCCAAGACGCAGCTCGGCCGTGGCCTCTTGATCCCCTACGCGCTCGTCGGCATCATC
AGCGTCGGTCTCGTCATCAGTTCCATCAGCAGCCTGATGCTCGAGCGTGGCAGCCGTCGGCTCGATGCCCGTATG
GAGGAAAAGCGCCGACGGAAAGTCATAACCGCCATGACTCGCAAGGGCGAAGACGACATCCTGACTCCCCTGCCC
CCGGGCCCCATCAGCAACATGAGGGTGTCGGACGATCCGCTGGCCGACGAGTTCGACCGCCGCCGCTGCGAGTTC
GACCTGATGCGCATGATACAGAAGACGGCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCCTCTCGTTTAGCATC
TGGGTCGTCCTCTGGCTCGTCGGCGCCGCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTC
GAGGCCTTTTACTACTGCTTCATCTCGTTGCTGACCATCGGCTACGGCGACCTTCACGTCGTCTCCAACGCTGGC
CGCTCGTTCTTCGTCTTCTGGTCGCTCATGGCGCTGCCCACCATGACGGTCCTCATCTCCAACGCCGGAGACACC
GTCGTCAAGCTCATCAACGACTACACAAACTACCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGC
CACACCCTCAAGCGCATCGTCCACACCATCAGCTGCGGCCGCCTCTTCCCAAGCGTCAACCGCGCCGGCCCCGAT
GCCGAAGGCCTCGAGCGCTTAAACGAGAAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGTCAAGACGTCG
GCAAGTCCCAGCCTATCACGCGCCCTGTCCGTCATGCGCAGCAGCGCCGGCGTCCTCCTGCCCACCAACACAGCC
GCCAGCGGCAGCCTCTCGCGCGCAATGACGGCCGTCCAGAACACAACCGGCGTCCTCATACCCACCAACACGGCA
GAGCGCCAATCCCTCAACCGCGTCCACGACATCCTCGGCGCCCTTCCCACCGGCAACGATTTCAACCTCCTGCTC
ATCACCGAGATCCAATCGGTAGCCAAGCACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCC
TGGTACCTTGGCCTCATAGGCGAAGACGAGCGCAAACCCGAGATGCACCGCAAGGCCATCCCCAAGGAAGAGCGC
AAGCACCCACGCCACCGCCACCACCCGCACAAGCACAGACACGCCCGGCGTCACCACCACAGCCAGCGCGAGACC
CACGCCCCGGCAGCGTCGTCATCTGCCCCGGCCGCCGCCGTCGTCGACGACGACGATGGCGTGGAGGATGATCTC
CTCAAGTGGTCCTGGGTCGGCAAGTACAGCCCGCTCGTCGGCGGACAGGAGGAGTCGGAGTGGATACTGGAGAGG
CTGATGATGAGTCTCCACGAGTCGCTTTGGAAGACGCGCGTTGCTCACGATGAGGGCCTGTCCGAGACGGCGGCG
TCGGTATGA
Transcript >Ophcf2|01369
ATGGTTGATAGTCCGCTCATCGACGCCTCTGATCCCCTGGCCCGTGTCGCCACGTCTCTTCTGCGGCCTGAGTTT
CCTCTGGAGGCTCGCTTTCAGAATGACGACTCCCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGTTGCCGGCACCTTGGGACCAGTCGCCTCGGCCTTCAGCATCTGCGCCCTTGTGCGTCAATGGCGACAG
CATGTCCCGCCCGAGACCGACCTCGACGCCGCAACCTTTGTGCCCGACCCTCCCTGGCTTCTCATCATCAACGCC
ATCCAGCTGGCCGTTGCCCTAGTCGCCAACATCATGCTCCTACTCAACATGGCCAAGAGGGTGCGCTTCACCATT
GCGCAGCCCATTACAATTGTCGGCTGGTACATCTCTTCTATCCTCCTCATAGCCTGTACCGCGACCGCCAGCGGC
CCCCTGAGACGTAGCCTCGACCCTCCCGACGAATACGTCTGGTCCCAGGCCTTTTACTACGGCATCTGGGCCGCC
ATTCTTTACTTCATCGTCGCCTCCCTCATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGAC
TTTAACCTGACCAACAGCCAGCGCACCCTCATGTTGCAGACCATTGCCGTCCTGGCCTACCTGCTCATCGGCGCC
CTCATCTTCTCCAAGATCGAGGACTGGCCCTACCTCGATGCTGTCTACTGGGCCGACGTGACGCTCTTCACCATC
GGCTTCGGAGACTTTGCGCCCAAGACGCAGCTCGGCCGTGGCCTCTTGATCCCCTACGCGCTCGTCGGCATCATC
AGCGTCGGTCTCGTCATCAGTTCCATCAGCAGCCTGATGCTCGAGCGTGGCAGCCGTCGGCTCGATGCCCGTATG
GAGGAAAAGCGCCGACGGAAAGTCATAACCGCCATGACTCGCAAGGGCGAAGACGACATCCTGACTCCCCTGCCC
CCGGGCCCCATCAGCAACATGAGGGTGTCGGACGATCCGCTGGCCGACGAGTTCGACCGCCGCCGCTGCGAGTTC
GACCTGATGCGCATGATACAGAAGACGGCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCCTCTCGTTTAGCATC
TGGGTCGTCCTCTGGCTCGTCGGCGCCGCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTC
GAGGCCTTTTACTACTGCTTCATCTCGTTGCTGACCATCGGCTACGGCGACCTTCACGTCGTCTCCAACGCTGGC
CGCTCGTTCTTCGTCTTCTGGTCGCTCATGGCGCTGCCCACCATGACGGTCCTCATCTCCAACGCCGGAGACACC
GTCGTCAAGCTCATCAACGACTACACAAACTACCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGC
CACACCCTCAAGCGCATCGTCCACACCATCAGCTGCGGCCGCCTCTTCCCAAGCGTCAACCGCGCCGGCCCCGAT
GCCGAAGGCCTCGAGCGCTTAAACGAGAAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGTCAAGACGTCG
GCAAGTCCCAGCCTATCACGCGCCCTGTCCGTCATGCGCAGCAGCGCCGGCGTCCTCCTGCCCACCAACACAGCC
GCCAGCGGCAGCCTCTCGCGCGCAATGACGGCCGTCCAGAACACAACCGGCGTCCTCATACCCACCAACACGGCA
GAGCGCCAATCCCTCAACCGCGTCCACGACATCCTCGGCGCCCTTCCCACCGGCAACGATTTCAACCTCCTGCTC
ATCACCGAGATCCAATCGGTAGCCAAGCACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCC
TGGTACCTTGGCCTCATAGGCGAAGACGAGCGCAAACCCGAGATGCACCGCAAGGCCATCCCCAAGGAAGAGCGC
AAGCACCCACGCCACCGCCACCACCCGCACAAGCACAGACACGCCCGGCGTCACCACCACAGCCAGCGCGAGACC
CACGCCCCGGCAGCGTCGTCATCTGCCCCGGCCGCCGCCGTCGTCGACGACGACGATGGCGTGGAGGATGATCTC
CTCAAGTGGTCCTGGGTCGGCAAGTACAGCCCGCTCGTCGGCGGACAGGAGGAGTCGGAGTGGATACTGGAGAGG
CTGATGATGAGTCTCCACGAGTCGCTTTGGAAGACGCGCGTTGCTCACGATGAGGGCCTGTCCGAGACGGCGGCG
TCGGTATGA
Gene >Ophcf2|01369
ATGGTTGATAGTCCGCTCATCGACGCCTCTGATCCCCTGGCCCGTGTCGCCACGTCTCTTCTGCGGCCTGAGTTT
CCTCTGGAGGCTCGCTTTCAGAATGACGACTCCCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGTTGCCGGCACCTTGGGACCAGTCGCCTCGGCCTTCAGCATCTGCGCCCTTGTGCGTCAATGGCGACAG
CATGTCCCGCCCGAGACCGACCTCGACGCCGCAACCTTTGTGCCCGACCCTCCCTGGTAAGAGGAGCGCCATGCT
CGTCTCTTCCGCTGCTGACATTGGTTCAGGCTTCTCATCATCAACGCCATCCAGCTGGCCGTTGCCCTAGTCGCC
AACATCATGCTCCTACTCAACATGGCCAAGAGGGTGCGCTTCACCATTGCGCAGCCCATTACAATTGTCGGCTGG
TACATCTCTTCTATCCTCCTCATAGCCTGTACCGCGACCGCCAGCGGCCCCCTGAGACGTAGCCTCGACCCTCCC
GACGAATACGTCTGGTCCCAGGCCTTTTACTACGGCATCTGGGCCGCCATTCTTTACTTCATCGTCGCCTCCCTC
ATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGACTTTAACCTGACCAACAGCCAGCGCACC
CTCATGTTGCAGACCATTGCCGTCCTGGCCTACCTGCTCATCGGCGCCCTCATCTTCTCCAAGATCGAGGACTGG
CCCTACCTCGATGCTGTCTACTGGGCCGACGTGACGCTCTTCACCATCGGCTTCGGAGACTTTGCGCCCAAGACG
CAGCTCGGCCGTGGCCTCTTGATCCCCTACGCGCTCGTCGGCATCATCAGCGTCGGTCTCGTCATCAGTTCCATC
AGCAGCCTGATGCTCGAGCGTGGCAGCCGTCGGCTCGATGCCCGTATGGAGGAAAAGCGCCGACGGAAAGTCATA
ACCGCCATGACTCGCAAGGGCGAAGACGACATCCTGACTCCCCTGCCCCCGGGCCCCATCAGCAACATGAGGGTG
TCGGACGATCCGCTGGCCGACGAGTTCGACCGCCGCCGCTGCGAGTTCGACCTGATGCGCATGATACAGAAGACG
GCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCCTCTCGTTTAGCATCTGGGTCGTCCTCTGGCTCGTCGGCGCC
GCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTCGAGGCCTTTTACTACTGCTTCATCTCG
TTGCTGACCATCGGCTACGGCGACCTTCACGTCGTCTCCAACGCTGGCCGCTCGTTCTTCGTCTTCTGGTCGCTC
ATGGCGCTGCCCACCATGACGGTCCTCATCTCCAACGCCGGAGACACCGTCGTCAAGCTCATCAACGACTACACA
AACTACCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGCCACACCCTCAAGCGCATCGTCCACACC
ATCAGCTGCGGCCGCCTCTTCCCAAGCGTCAACCGCGCCGGCCCCGATGCCGAAGGCCTCGAGCGCTTAAACGAG
AAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGTCAAGACGTCGGCAAGTCCCAGCCTATCACGCGCCCTG
TCCGTCATGCGCAGCAGCGCCGGCGTCCTCCTGCCCACCAACACAGCCGCCAGCGGCAGCCTCTCGCGCGCAATG
ACGGCCGTCCAGAACACAACCGGCGTCCTCATACCCACCAACACGGCAGAGCGCCAATCCCTCAACCGCGTCCAC
GACATCCTCGGCGCCCTTCCCACCGGCAACGATTTCAACCTCCTGCTCATCACCGAGATCCAATCGGTAGCCAAG
CACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCCTGGTACCTTGGCCTCATAGGCGAAGAC
GAGCGCAAACCCGAGATGCACCGCAAGGCCATCCCCAAGGAAGAGCGCAAGCACCCACGCCACCGCCACCACCCG
CACAAGCACAGACACGCCCGGCGTCACCACCACAGCCAGCGCGAGACCCACGCCCCGGCAGCGTCGTCATCTGCC
CCGGCCGCCGCCGTCGTCGACGACGACGATGGCGTGGAGGATGATCTCCTCAAGTGGTCCTGGGTCGGCAAGTAC
AGCCCGCTCGTCGGCGGACAGGAGGAGTCGGAGTGGATACTGGAGAGGCTGATGATGAGTCTCCACGAGTCGCTT
TGGAAGACGCGCGTTGCTCACGATGAGGGCCTGTCCGAGACGGCGGCGTCGGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail