Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01369
Gene name
Locationscaffold_01:4819205..4821512
Strand+
Gene length (bp)2307
Transcript length (bp)2259
Coding sequence length (bp)2259
Protein length (aa) 753

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07885 Ion_trans_2 Ion channel 9.4E-16 216 288
PF07885 Ion_trans_2 Ion channel 2.1E-17 375 452

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 95 117 22
2 130 152 22
3 167 189 22
4 210 229 19
5 265 287 22
6 367 389 22
7 399 421 22
8 428 445 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01369
MVDSPLIDASDPLARVATSLLRPEFPLEARFQNDDSHLVPSRLWFASSAFPMVAGTLGPVASAFSICALVRQWRQ
HVPPETDLDAATFVPDPPWLLIINAIQLAVALVANIMLLLNMAKRVRFTIAQPITIVGWYISSILLIACTATASG
PLRRSLDPPDEYVWSQAFYYGIWAAILYFIVASLMAVTFCGAWSGHYDKDFNLTNSQRTLMLQTIAVLAYLLIGA
LIFSKIEDWPYLDAVYWADVTLFTIGFGDFAPKTQLGRGLLIPYALVGIISVGLVISSISSLMLERGSRRLDARM
EEKRRRKVITAMTRKGEDDILTPLPPGPISNMRVSDDPLADEFDRRRCEFDLMRMIQKTASSRRRWLAMALSFSI
WVVLWLVGAAVFYACEWSYQHWTYFEAFYYCFISLLTIGYGDLHVVSNAGRSFFVFWSLMALPTMTVLISNAGDT
VVKLINDYTNYLGNLTILPGDEPLGHTLKRIVHTISCGRLFPSVNRAGPDAEGLERLNEKTDQPWGDVQATVKTS
ASPSLSRALSVMRSSAGVLLPTNTAASGSLSRAMTAVQNTTGVLIPTNTAERQSLNRVHDILGALPTGNDFNLLL
ITEIQSVAKHLREDEPRRYSFEEWAWYLGLIGEDERKPEMHRKAIPKEERKHPRHRHHPHKHRHARRHHHSQRET
HAPAASSSAPAAAVVDDDDGVEDDLLKWSWVGKYSPLVGGQEESEWILERLMMSLHESLWKTRVAHDEGLSETAA
SV*
Coding >Ophcf2|01369
ATGGTTGATAGTCCGCTCATCGACGCCTCTGATCCCCTGGCCCGTGTCGCCACGTCTCTTCTGCGGCCTGAGTTT
CCTCTGGAGGCTCGCTTTCAGAATGACGACTCCCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGTTGCCGGCACCTTGGGACCAGTCGCCTCGGCCTTCAGCATCTGCGCCCTTGTGCGTCAATGGCGACAG
CATGTCCCGCCCGAGACCGACCTCGACGCCGCAACCTTTGTGCCCGACCCTCCCTGGCTTCTCATCATCAACGCC
ATCCAGCTGGCCGTTGCCCTAGTCGCCAACATCATGCTCCTACTCAACATGGCCAAGAGGGTGCGCTTCACCATT
GCGCAGCCCATTACAATTGTCGGCTGGTACATCTCTTCTATCCTCCTCATAGCCTGTACCGCGACCGCCAGCGGC
CCCCTGAGACGTAGCCTCGACCCTCCCGACGAATACGTCTGGTCCCAGGCCTTTTACTACGGCATCTGGGCCGCC
ATTCTTTACTTCATCGTCGCCTCCCTCATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGAC
TTTAACCTGACCAACAGCCAGCGCACCCTCATGTTGCAGACCATTGCCGTCCTGGCCTACCTGCTCATCGGCGCC
CTCATCTTCTCCAAGATCGAGGACTGGCCCTACCTCGATGCTGTCTACTGGGCCGACGTGACGCTCTTCACCATC
GGCTTCGGAGACTTTGCGCCCAAGACGCAGCTCGGCCGTGGCCTCTTGATCCCCTACGCGCTCGTCGGCATCATC
AGCGTCGGTCTCGTCATCAGTTCCATCAGCAGCCTGATGCTCGAGCGTGGCAGCCGTCGGCTCGATGCCCGTATG
GAGGAAAAGCGCCGACGGAAAGTCATAACCGCCATGACTCGCAAGGGCGAAGACGACATCCTGACTCCCCTGCCC
CCGGGCCCCATCAGCAACATGAGGGTGTCGGACGATCCGCTGGCCGACGAGTTCGACCGCCGCCGCTGCGAGTTC
GACCTGATGCGCATGATACAGAAGACGGCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCCTCTCGTTTAGCATC
TGGGTCGTCCTCTGGCTCGTCGGCGCCGCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTC
GAGGCCTTTTACTACTGCTTCATCTCGTTGCTGACCATCGGCTACGGCGACCTTCACGTCGTCTCCAACGCTGGC
CGCTCGTTCTTCGTCTTCTGGTCGCTCATGGCGCTGCCCACCATGACGGTCCTCATCTCCAACGCCGGAGACACC
GTCGTCAAGCTCATCAACGACTACACAAACTACCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGC
CACACCCTCAAGCGCATCGTCCACACCATCAGCTGCGGCCGCCTCTTCCCAAGCGTCAACCGCGCCGGCCCCGAT
GCCGAAGGCCTCGAGCGCTTAAACGAGAAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGTCAAGACGTCG
GCAAGTCCCAGCCTATCACGCGCCCTGTCCGTCATGCGCAGCAGCGCCGGCGTCCTCCTGCCCACCAACACAGCC
GCCAGCGGCAGCCTCTCGCGCGCAATGACGGCCGTCCAGAACACAACCGGCGTCCTCATACCCACCAACACGGCA
GAGCGCCAATCCCTCAACCGCGTCCACGACATCCTCGGCGCCCTTCCCACCGGCAACGATTTCAACCTCCTGCTC
ATCACCGAGATCCAATCGGTAGCCAAGCACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCC
TGGTACCTTGGCCTCATAGGCGAAGACGAGCGCAAACCCGAGATGCACCGCAAGGCCATCCCCAAGGAAGAGCGC
AAGCACCCACGCCACCGCCACCACCCGCACAAGCACAGACACGCCCGGCGTCACCACCACAGCCAGCGCGAGACC
CACGCCCCGGCAGCGTCGTCATCTGCCCCGGCCGCCGCCGTCGTCGACGACGACGATGGCGTGGAGGATGATCTC
CTCAAGTGGTCCTGGGTCGGCAAGTACAGCCCGCTCGTCGGCGGACAGGAGGAGTCGGAGTGGATACTGGAGAGG
CTGATGATGAGTCTCCACGAGTCGCTTTGGAAGACGCGCGTTGCTCACGATGAGGGCCTGTCCGAGACGGCGGCG
TCGGTATGA
Transcript >Ophcf2|01369
ATGGTTGATAGTCCGCTCATCGACGCCTCTGATCCCCTGGCCCGTGTCGCCACGTCTCTTCTGCGGCCTGAGTTT
CCTCTGGAGGCTCGCTTTCAGAATGACGACTCCCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGTTGCCGGCACCTTGGGACCAGTCGCCTCGGCCTTCAGCATCTGCGCCCTTGTGCGTCAATGGCGACAG
CATGTCCCGCCCGAGACCGACCTCGACGCCGCAACCTTTGTGCCCGACCCTCCCTGGCTTCTCATCATCAACGCC
ATCCAGCTGGCCGTTGCCCTAGTCGCCAACATCATGCTCCTACTCAACATGGCCAAGAGGGTGCGCTTCACCATT
GCGCAGCCCATTACAATTGTCGGCTGGTACATCTCTTCTATCCTCCTCATAGCCTGTACCGCGACCGCCAGCGGC
CCCCTGAGACGTAGCCTCGACCCTCCCGACGAATACGTCTGGTCCCAGGCCTTTTACTACGGCATCTGGGCCGCC
ATTCTTTACTTCATCGTCGCCTCCCTCATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGAC
TTTAACCTGACCAACAGCCAGCGCACCCTCATGTTGCAGACCATTGCCGTCCTGGCCTACCTGCTCATCGGCGCC
CTCATCTTCTCCAAGATCGAGGACTGGCCCTACCTCGATGCTGTCTACTGGGCCGACGTGACGCTCTTCACCATC
GGCTTCGGAGACTTTGCGCCCAAGACGCAGCTCGGCCGTGGCCTCTTGATCCCCTACGCGCTCGTCGGCATCATC
AGCGTCGGTCTCGTCATCAGTTCCATCAGCAGCCTGATGCTCGAGCGTGGCAGCCGTCGGCTCGATGCCCGTATG
GAGGAAAAGCGCCGACGGAAAGTCATAACCGCCATGACTCGCAAGGGCGAAGACGACATCCTGACTCCCCTGCCC
CCGGGCCCCATCAGCAACATGAGGGTGTCGGACGATCCGCTGGCCGACGAGTTCGACCGCCGCCGCTGCGAGTTC
GACCTGATGCGCATGATACAGAAGACGGCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCCTCTCGTTTAGCATC
TGGGTCGTCCTCTGGCTCGTCGGCGCCGCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTC
GAGGCCTTTTACTACTGCTTCATCTCGTTGCTGACCATCGGCTACGGCGACCTTCACGTCGTCTCCAACGCTGGC
CGCTCGTTCTTCGTCTTCTGGTCGCTCATGGCGCTGCCCACCATGACGGTCCTCATCTCCAACGCCGGAGACACC
GTCGTCAAGCTCATCAACGACTACACAAACTACCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGC
CACACCCTCAAGCGCATCGTCCACACCATCAGCTGCGGCCGCCTCTTCCCAAGCGTCAACCGCGCCGGCCCCGAT
GCCGAAGGCCTCGAGCGCTTAAACGAGAAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGTCAAGACGTCG
GCAAGTCCCAGCCTATCACGCGCCCTGTCCGTCATGCGCAGCAGCGCCGGCGTCCTCCTGCCCACCAACACAGCC
GCCAGCGGCAGCCTCTCGCGCGCAATGACGGCCGTCCAGAACACAACCGGCGTCCTCATACCCACCAACACGGCA
GAGCGCCAATCCCTCAACCGCGTCCACGACATCCTCGGCGCCCTTCCCACCGGCAACGATTTCAACCTCCTGCTC
ATCACCGAGATCCAATCGGTAGCCAAGCACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCC
TGGTACCTTGGCCTCATAGGCGAAGACGAGCGCAAACCCGAGATGCACCGCAAGGCCATCCCCAAGGAAGAGCGC
AAGCACCCACGCCACCGCCACCACCCGCACAAGCACAGACACGCCCGGCGTCACCACCACAGCCAGCGCGAGACC
CACGCCCCGGCAGCGTCGTCATCTGCCCCGGCCGCCGCCGTCGTCGACGACGACGATGGCGTGGAGGATGATCTC
CTCAAGTGGTCCTGGGTCGGCAAGTACAGCCCGCTCGTCGGCGGACAGGAGGAGTCGGAGTGGATACTGGAGAGG
CTGATGATGAGTCTCCACGAGTCGCTTTGGAAGACGCGCGTTGCTCACGATGAGGGCCTGTCCGAGACGGCGGCG
TCGGTATGA
Gene >Ophcf2|01369
ATGGTTGATAGTCCGCTCATCGACGCCTCTGATCCCCTGGCCCGTGTCGCCACGTCTCTTCTGCGGCCTGAGTTT
CCTCTGGAGGCTCGCTTTCAGAATGACGACTCCCATCTCGTCCCCAGCCGGCTCTGGTTCGCCTCGTCGGCCTTT
CCCATGGTTGCCGGCACCTTGGGACCAGTCGCCTCGGCCTTCAGCATCTGCGCCCTTGTGCGTCAATGGCGACAG
CATGTCCCGCCCGAGACCGACCTCGACGCCGCAACCTTTGTGCCCGACCCTCCCTGGTAAGAGGAGCGCCATGCT
CGTCTCTTCCGCTGCTGACATTGGTTCAGGCTTCTCATCATCAACGCCATCCAGCTGGCCGTTGCCCTAGTCGCC
AACATCATGCTCCTACTCAACATGGCCAAGAGGGTGCGCTTCACCATTGCGCAGCCCATTACAATTGTCGGCTGG
TACATCTCTTCTATCCTCCTCATAGCCTGTACCGCGACCGCCAGCGGCCCCCTGAGACGTAGCCTCGACCCTCCC
GACGAATACGTCTGGTCCCAGGCCTTTTACTACGGCATCTGGGCCGCCATTCTTTACTTCATCGTCGCCTCCCTC
ATGGCCGTCACCTTCTGTGGCGCCTGGTCTGGCCACTACGACAAGGACTTTAACCTGACCAACAGCCAGCGCACC
CTCATGTTGCAGACCATTGCCGTCCTGGCCTACCTGCTCATCGGCGCCCTCATCTTCTCCAAGATCGAGGACTGG
CCCTACCTCGATGCTGTCTACTGGGCCGACGTGACGCTCTTCACCATCGGCTTCGGAGACTTTGCGCCCAAGACG
CAGCTCGGCCGTGGCCTCTTGATCCCCTACGCGCTCGTCGGCATCATCAGCGTCGGTCTCGTCATCAGTTCCATC
AGCAGCCTGATGCTCGAGCGTGGCAGCCGTCGGCTCGATGCCCGTATGGAGGAAAAGCGCCGACGGAAAGTCATA
ACCGCCATGACTCGCAAGGGCGAAGACGACATCCTGACTCCCCTGCCCCCGGGCCCCATCAGCAACATGAGGGTG
TCGGACGATCCGCTGGCCGACGAGTTCGACCGCCGCCGCTGCGAGTTCGACCTGATGCGCATGATACAGAAGACG
GCCTCGTCGCGTCGCCGCTGGCTGGCCATGGCCCTCTCGTTTAGCATCTGGGTCGTCCTCTGGCTCGTCGGCGCC
GCCGTCTTCTACGCCTGCGAATGGTCGTATCAGCACTGGACCTACTTCGAGGCCTTTTACTACTGCTTCATCTCG
TTGCTGACCATCGGCTACGGCGACCTTCACGTCGTCTCCAACGCTGGCCGCTCGTTCTTCGTCTTCTGGTCGCTC
ATGGCGCTGCCCACCATGACGGTCCTCATCTCCAACGCCGGAGACACCGTCGTCAAGCTCATCAACGACTACACA
AACTACCTCGGCAACCTGACCATCCTTCCCGGCGACGAGCCCCTGGGCCACACCCTCAAGCGCATCGTCCACACC
ATCAGCTGCGGCCGCCTCTTCCCAAGCGTCAACCGCGCCGGCCCCGATGCCGAAGGCCTCGAGCGCTTAAACGAG
AAGACGGACCAGCCCTGGGGCGACGTCCAGGCCACGGTCAAGACGTCGGCAAGTCCCAGCCTATCACGCGCCCTG
TCCGTCATGCGCAGCAGCGCCGGCGTCCTCCTGCCCACCAACACAGCCGCCAGCGGCAGCCTCTCGCGCGCAATG
ACGGCCGTCCAGAACACAACCGGCGTCCTCATACCCACCAACACGGCAGAGCGCCAATCCCTCAACCGCGTCCAC
GACATCCTCGGCGCCCTTCCCACCGGCAACGATTTCAACCTCCTGCTCATCACCGAGATCCAATCGGTAGCCAAG
CACCTACGCGAAGACGAGCCCCGACGCTACTCCTTCGAGGAATGGGCCTGGTACCTTGGCCTCATAGGCGAAGAC
GAGCGCAAACCCGAGATGCACCGCAAGGCCATCCCCAAGGAAGAGCGCAAGCACCCACGCCACCGCCACCACCCG
CACAAGCACAGACACGCCCGGCGTCACCACCACAGCCAGCGCGAGACCCACGCCCCGGCAGCGTCGTCATCTGCC
CCGGCCGCCGCCGTCGTCGACGACGACGATGGCGTGGAGGATGATCTCCTCAAGTGGTCCTGGGTCGGCAAGTAC
AGCCCGCTCGTCGGCGGACAGGAGGAGTCGGAGTGGATACTGGAGAGGCTGATGATGAGTCTCCACGAGTCGCTT
TGGAAGACGCGCGTTGCTCACGATGAGGGCCTGTCCGAGACGGCGGCGTCGGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail