Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01357
Gene name
Locationscaffold_01:4779815..4785843
Strand-
Gene length (bp)6028
Transcript length (bp)5871
Coding sequence length (bp)5871
Protein length (aa) 1957

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16507 BLM10_mid Proteasome-substrate-size regulator, mid region 3.6E-194 385 912
PF11919 DUF3437 Domain of unknown function (DUF3437) 1.9E-29 1868 1956
PF16547 BLM10_N Proteasome-substrate-size regulator, N-terminal 4.7E-19 34 99

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.5919 0.7397 0.0739 0.1081 0.1259 0.0379 0.0782 0.1137 0.1085 0.0141

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1633
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7072
Ophiocordyceps australis map64 (Brazil) OphauB2|2633
Ophiocordyceps camponoti-floridani Ophcf2|01357 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5542
Ophiocordyceps kimflemingae Ophio5|7756
Ophiocordyceps subramaniannii Hirsu2|1308

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01357
MDENIDISHEAAHATHVPSMTSHLVSSFAVLEPVSRSTSPGIPYPKTDEDDKKRYRPRTFAYFQQLPFEVEEESE
RDAALNGILKQLYIALRAQDYSPGALHWTRELQAWLNLKFEMTRELRARLAQLFYSLSLAPGLDANAADRFLRMV
ITLTRKNHYLKPVDDLLLDWRPLWKEVKAWVLPSEGPSHQSTRRRAAKQLLKLCTHAHTYFDPSQRPAVIEKLLP
YFGVNELPNAFIVVGTLNALLPSHPAPASEPLAQPQHFLPTLFHLWSIVNRSKVIDIFFMDLFSRLTRDHIHCHH
VPFGQFGIFTRDQSDLIFTAMLRLTQIPVGQANSPYTSIDYLSGAGLYLEKDKKKYPVAYMMARLVTSSLSPSCL
DHPDSIMSSLEGLIESIDTFFHPSNQGSWSNLLGQFVLYLTDGFVSRWNREQSGELDIPNGRKISSQLKKRFVLS
LREVTFMGLFSKSSRISHCYYNALQGLAYLEPDLVLPGALQRFYPSLQGLVEVHRTTSSLNGLQMIANTMCKLKG
YRCHVTALLALALPGIDANDLNKTQYTLNFIQSVAYSVPFVSMTTEDSHIHDTTLAMQWVQAEMDRMERDGQNVQ
IDYAAELSDEDETRILRSSTAGLSEFVLTLLGKIFTLLENLPDANQVRGGTPEDNVINALPSALSPLFASLSPDI
FDMALDKIATFVSSHVVHQARDAMAWILNALCKVDPAKTLKVFVPMLVVNIRSEIDYNNAASDRTTGTDYLPRDR
ALVWHISMLAMCVVHVGGEVLKYKEELLGIAEYMQDKCRGLPTILVSNYIHHLLLNLTHTYPIDHALYEPDVLKR
GLDVGDWGRTTAPADLTIRWHQPSPAEVEFAVELFASQVTSATRQLQLLMSDNPPVSREGKNKAWSDEVSRLMQQ
MRLAISGMAIMFDPKRASDDGGSDGEGGGNADGDEDMMDEDEMLAGDADEEEEELRPQFRYRAGYPLKPKDPVYR
RIHELRDEIGHLLTRTHSFLNEKQEDDVNCFTALCSAYRTWITDVGIERSAHPLERHLRLYRADVAAFKIKGLRK
VYPRPLLIKRAEAYHILRVKHNASARHKSELDKRLLRDLAHSCLSLYADVRRVAQSAQDSSLKSLIGGRPIVLPV
ILDGFRAAIEANQHDRIKGGMYTLLYTSLLRTVLKDWRFAPEAMRLYIETAGIDKPSIQTLGSTALYSMFEFGKP
LDRAILVDDVVVDSIKPPQGDESAAIDKRHQMVVQRRRKVEDAKSALGLELTRRAKGAHWKIATRCAIFAANLCL
RFEDIAPTEFVDLVARGVNDPHPSLRTFFLNSLSALFGVIDMRAVYDHDYNNYLLEKEINDTNKLEIAVAKGDAQ
FTRRFLDAFRDPEGAEYLVDSDHPGWLAWGKSFMAFRARPVPFMAYDEVEKAVRDQLGRVLTREWLSQCFDYLKQ
EPRDQCTDRFRMQHVYLLMHVFDLMHYGDTAVTFDDVKELTRGIYGDGSDKHQHRATSEILGALLTGSSDDPPEI
RNRVWGFAAPMLLGVLRDDLTPENLQYWLACLHLVLDGKDPRRSHEIVDGLKSFRLDMSSNAAFKESSKLQLVEF
IVADGGWHFRDTGPIQEHLVAHIDHPYKAVREAIGRLLSALEKSRFYEAFESVPRLLEENKAASSVGIRPYQPSP
ELTATMTGIFDRLERWRHERTPGQQTPSSYTSGSKTVLMWLDCTLSSHECVELVPFFATPFVEQLLHMMDVKEDP
ELMKLAYHVYRHLPNIPFRKGEDADLSESLIRVGRTAASWHQRLRALVNMQSLYFRRIFMLGAPQRDGLFTAVSD
MLSDAQLEVRSCASTTLAGMIRCSPGQIRGPMVARLKRRFEDELQQNPMPRRTQGGTETPVDVQRQVTRRHAAVL
GLGALIEAFPYATPPPEWMPEVLAMLARKASGDAGVVGKATKGILSEFKKTRQDSWSVDQKYFTSEQLEDLEGVL
WKSYFA*
Coding >Ophcf2|01357
ATGGACGAAAACATTGACATATCTCACGAGGCTGCCCACGCCACCCACGTCCCTTCCATGACGTCGCATCTCGTC
AGCAGCTTCGCCGTCTTGGAGCCCGTCTCCCGCTCCACGTCGCCCGGCATTCCCTATCCCAAGACGGACGAAGAC
GACAAGAAGCGATATCGCCCTCGAACATTTGCCTATTTCCAGCAGTTGCCTTTCGAGGTCGAGGAGGAGTCGGAG
CGCGACGCCGCCCTCAATGGCATTCTCAAGCAGCTGTACATCGCCCTGCGCGCCCAGGACTACTCGCCGGGCGCT
CTGCACTGGACTCGGGAGCTCCAGGCGTGGCTCAACCTCAAGTTCGAGATGACGAGGGAGCTGAGGGCGCGGCTG
GCCCAGCTCTTCTACTCGCTCTCTCTGGCTCCCGGGCTTGATGCCAACGCGGCGGATCGCTTTCTGCGCATGGTC
ATTACGCTCACCAGGAAAAATCATTACCTGAAGCCGGTCGACGACCTCCTCCTCGACTGGAGGCCCTTGTGGAAA
GAGGTCAAGGCCTGGGTTTTGCCCTCGGAGGGTCCCTCTCATCAGAGCACCCGCAGACGGGCGGCCAAGCAGCTC
CTCAAGCTCTGCACCCACGCTCACACCTACTTCGATCCTAGCCAGCGTCCGGCCGTGATAGAGAAACTGCTTCCT
TACTTTGGCGTCAACGAGCTTCCCAACGCCTTCATCGTCGTCGGCACCCTCAACGCCCTGCTGCCCAGCCATCCC
GCTCCGGCCAGCGAGCCCCTGGCCCAGCCGCAGCACTTCCTGCCGACCCTCTTCCACCTGTGGTCCATCGTGAAT
CGCTCCAAGGTGATCGATATCTTCTTCATGGACCTCTTCTCCCGCCTGACCCGCGACCACATTCACTGCCATCAC
GTTCCGTTTGGCCAGTTCGGCATCTTCACCCGGGACCAGTCGGACCTCATCTTCACCGCCATGCTCCGCCTGACG
CAGATTCCCGTCGGCCAGGCCAACTCGCCGTACACCTCGATCGATTACCTCTCGGGGGCCGGTCTCTACCTGGAA
AAGGACAAGAAAAAGTACCCTGTCGCGTACATGATGGCCCGCCTCGTCACCAGCAGCCTCTCCCCGAGTTGTCTG
GATCATCCGGACTCGATCATGTCGAGCCTTGAGGGCCTCATCGAGTCCATCGACACCTTCTTTCATCCGTCGAAC
CAAGGGTCCTGGTCTAACCTGCTGGGGCAATTCGTCCTCTACCTCACCGACGGCTTCGTTTCGCGGTGGAACCGC
GAGCAGAGCGGGGAGCTCGACATCCCGAACGGCCGCAAAATCAGCTCGCAACTGAAGAAGCGCTTCGTCCTCTCT
CTCAGGGAGGTGACCTTTATGGGCCTCTTCTCAAAGAGCAGCCGGATATCGCACTGCTACTACAACGCCCTCCAG
GGCCTGGCCTACCTGGAGCCGGACCTCGTGCTGCCCGGGGCGCTGCAGCGGTTCTACCCCAGTCTGCAAGGCCTG
GTCGAGGTCCACCGCACGACGTCGAGCTTGAACGGTCTCCAGATGATCGCCAATACCATGTGCAAGCTCAAGGGC
TATCGCTGCCACGTAACGGCCCTGCTGGCCCTCGCGCTGCCGGGCATCGACGCCAACGACCTCAACAAGACGCAG
TACACGCTCAACTTCATACAGAGCGTCGCCTACAGCGTGCCGTTCGTTTCCATGACGACCGAGGACAGCCACATC
CACGACACGACGCTGGCCATGCAGTGGGTGCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAG
ATCGACTACGCTGCCGAGCTCAGCGACGAGGACGAGACGCGGATCCTGAGGTCGTCGACGGCCGGGCTGAGCGAG
TTCGTCCTGACGCTCCTCGGCAAGATCTTCACCCTGCTGGAGAACCTGCCGGATGCCAACCAGGTCCGGGGCGGT
ACGCCGGAGGATAATGTCATCAACGCATTGCCTTCGGCGCTGTCGCCTCTGTTCGCCTCGCTGTCGCCGGACATC
TTCGACATGGCGCTCGACAAGATTGCTACTTTTGTCTCGAGCCACGTGGTGCACCAGGCTCGCGACGCCATGGCC
TGGATCCTCAACGCCCTGTGCAAGGTGGATCCGGCCAAGACGCTCAAGGTCTTCGTCCCGATGCTCGTCGTCAAC
ATTCGCAGCGAGATCGACTACAACAATGCCGCCTCGGATCGTACCACGGGCACCGACTACCTCCCCCGAGACCGG
GCTCTGGTCTGGCACATCAGCATGCTCGCCATGTGCGTCGTCCACGTCGGCGGCGAGGTGCTCAAGTACAAGGAG
GAGCTGCTGGGCATAGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATCCTCGTGTCCAACTACATC
CACCACCTGCTCCTGAACCTGACGCACACGTACCCCATCGACCACGCGCTGTACGAGCCGGACGTGCTAAAGAGG
GGGCTCGACGTCGGGGACTGGGGCAGGACGACGGCGCCGGCGGACCTCACCATCCGCTGGCACCAGCCCTCGCCG
GCCGAGGTCGAGTTCGCTGTGGAGCTTTTCGCGTCCCAGGTGACGTCTGCCACGCGGCAGCTGCAGCTCCTGATG
AGCGACAACCCGCCCGTGAGCAGGGAGGGCAAGAACAAGGCCTGGTCTGACGAGGTGTCGAGGCTCATGCAGCAA
ATGCGTCTTGCCATATCCGGCATGGCCATCATGTTTGATCCGAAGCGCGCGTCCGACGACGGCGGTAGCGACGGA
GAAGGCGGAGGCAACGCCGACGGCGACGAAGACATGATGGACGAAGACGAGATGCTGGCCGGAGACGCCGACGAG
GAGGAGGAGGAGCTCCGGCCGCAATTCCGATACCGGGCGGGTTACCCCCTGAAGCCCAAGGACCCGGTCTATCGG
CGGATACACGAGCTGCGCGACGAGATCGGCCACCTCCTGACCAGGACGCACTCGTTCCTCAACGAGAAGCAGGAA
GACGACGTCAACTGCTTCACCGCCCTGTGCTCGGCGTATCGCACGTGGATCACGGACGTGGGCATCGAGCGATCG
GCCCACCCGCTCGAGAGGCACCTGAGGCTGTACAGGGCAGACGTGGCCGCCTTCAAGATCAAGGGGCTGAGGAAG
GTCTACCCCCGGCCGCTACTGATCAAGCGGGCCGAGGCGTACCACATCCTGCGAGTTAAGCACAACGCGTCGGCA
AGGCATAAGAGCGAGCTTGACAAGCGACTCCTGCGCGACCTGGCGCACTCGTGCTTGAGCCTGTACGCCGACGTG
CGGAGGGTGGCGCAGAGCGCGCAGGACTCTTCACTCAAGTCCCTCATCGGCGGCCGGCCCATCGTGCTCCCCGTC
ATACTCGACGGCTTCCGCGCCGCCATCGAGGCCAACCAGCACGACCGGATCAAGGGCGGCATGTATACGCTGCTC
TACACGTCGCTGCTGCGGACGGTCCTCAAGGACTGGCGTTTCGCGCCCGAGGCCATGCGGCTGTACATCGAGACG
GCCGGCATCGACAAGCCGTCCATCCAGACGCTGGGCTCGACGGCGCTCTACTCCATGTTCGAGTTCGGCAAGCCT
CTCGACCGGGCCATCCTGGTGGACGACGTCGTGGTCGACTCGATCAAGCCGCCGCAGGGCGACGAGTCGGCGGCC
ATCGACAAGAGGCATCAGATGGTGGTGCAGAGGCGCAGGAAGGTCGAGGACGCCAAGTCGGCGCTCGGGCTGGAG
CTGACGCGGAGGGCAAAGGGAGCGCACTGGAAGATTGCGACTAGATGCGCCATATTTGCCGCCAACTTGTGCCTC
CGCTTCGAAGACATCGCGCCGACCGAGTTTGTGGACCTGGTGGCCCGGGGCGTCAACGACCCGCACCCCAGTCTG
AGGACCTTCTTCTTGAACTCGCTGTCGGCCCTCTTCGGCGTCATCGACATGCGGGCCGTCTACGATCACGACTAC
AACAACTACCTCCTGGAGAAGGAGATCAACGACACCAACAAGCTCGAGATAGCCGTGGCCAAGGGCGACGCCCAG
TTCACGCGCCGCTTCCTCGACGCCTTCCGGGACCCCGAGGGCGCCGAATACCTGGTCGATTCTGACCATCCGGGG
TGGCTCGCTTGGGGGAAGAGCTTCATGGCGTTTCGGGCTCGTCCCGTGCCCTTTATGGCGTACGACGAGGTCGAG
AAGGCGGTGAGGGATCAGCTTGGTAGGGTGCTGACGAGAGAGTGGTTGTCGCAGTGCTTCGACTACCTCAAGCAG
GAGCCGCGCGATCAGTGTACCGACAGATTTAGGATGCAGCACGTGTATCTGCTGATGCACGTCTTCGACCTGATG
CACTACGGCGACACGGCGGTGACGTTTGACGACGTCAAGGAGCTGACGCGCGGCATCTACGGCGACGGGAGCGAC
AAGCACCAACACCGGGCGACGTCGGAGATCTTGGGGGCGCTGCTGACCGGTTCGAGCGACGACCCGCCCGAGATC
CGGAACCGCGTATGGGGGTTTGCGGCGCCCATGCTGCTGGGAGTCCTCAGGGACGACCTGACGCCGGAGAATCTG
CAGTACTGGCTGGCGTGTCTGCACCTGGTGCTCGACGGCAAGGACCCTCGCCGTTCGCACGAGATCGTCGACGGG
CTCAAGTCGTTCCGGCTCGACATGTCGTCCAACGCGGCCTTCAAGGAGTCTTCCAAGTTGCAGCTCGTCGAATTC
ATCGTGGCCGACGGCGGGTGGCACTTTCGCGACACGGGGCCGATCCAGGAGCACCTGGTGGCGCACATCGACCAC
CCGTACAAGGCGGTGCGTGAGGCCATCGGGCGGCTGCTGTCGGCGCTGGAGAAGTCACGGTTCTACGAGGCGTTT
GAGAGCGTGCCGAGGCTGCTGGAGGAGAACAAGGCGGCGTCGTCGGTCGGCATCCGGCCGTACCAGCCGTCGCCG
GAGCTGACGGCGACCATGACGGGCATCTTTGATCGGCTGGAGCGGTGGCGGCACGAGCGGACGCCGGGGCAGCAG
ACGCCGTCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTGGACTGCACGCTGTCGTCGCACGAGTGC
GTGGAGCTGGTGCCCTTCTTCGCGACGCCCTTTGTGGAGCAGCTGCTGCACATGATGGACGTCAAGGAGGACCCG
GAGCTCATGAAGCTGGCCTACCACGTGTACCGACACCTGCCCAACATACCCTTCCGCAAGGGCGAGGACGCGGAC
CTGAGCGAGAGCCTCATCCGGGTCGGGCGGACGGCGGCGAGCTGGCACCAGAGGCTGCGGGCGCTGGTCAACATG
CAGAGCCTCTACTTCCGGCGCATCTTCATGCTCGGGGCGCCGCAGCGCGACGGGCTCTTCACCGCCGTGTCGGAC
ATGCTGAGCGACGCGCAGCTCGAGGTGCGGTCGTGCGCGTCGACGACGCTGGCGGGCATGATCCGGTGCTCGCCG
GGGCAGATACGGGGCCCCATGGTGGCGAGGCTCAAGCGGCGCTTCGAGGATGAGCTGCAGCAGAACCCGATGCCG
CGGCGGACGCAGGGCGGGACGGAGACGCCTGTGGATGTGCAGCGGCAGGTGACGAGGCGACACGCAGCGGTGCTG
GGGCTGGGGGCGCTGATTGAGGCGTTTCCGTACGCGACGCCGCCGCCCGAGTGGATGCCCGAGGTGTTGGCGATG
CTGGCGCGCAAGGCGTCGGGAGACGCGGGCGTGGTGGGCAAGGCGACCAAGGGGATCTTGAGCGAGTTCAAGAAG
ACGAGGCAGGACAGCTGGAGCGTGGATCAGAAGTACTTTACGTCGGAACAGCTCGAGGATCTGGAAGGGGTGCTG
TGGAAGAGCTACTTTGCCTGA
Transcript >Ophcf2|01357
ATGGACGAAAACATTGACATATCTCACGAGGCTGCCCACGCCACCCACGTCCCTTCCATGACGTCGCATCTCGTC
AGCAGCTTCGCCGTCTTGGAGCCCGTCTCCCGCTCCACGTCGCCCGGCATTCCCTATCCCAAGACGGACGAAGAC
GACAAGAAGCGATATCGCCCTCGAACATTTGCCTATTTCCAGCAGTTGCCTTTCGAGGTCGAGGAGGAGTCGGAG
CGCGACGCCGCCCTCAATGGCATTCTCAAGCAGCTGTACATCGCCCTGCGCGCCCAGGACTACTCGCCGGGCGCT
CTGCACTGGACTCGGGAGCTCCAGGCGTGGCTCAACCTCAAGTTCGAGATGACGAGGGAGCTGAGGGCGCGGCTG
GCCCAGCTCTTCTACTCGCTCTCTCTGGCTCCCGGGCTTGATGCCAACGCGGCGGATCGCTTTCTGCGCATGGTC
ATTACGCTCACCAGGAAAAATCATTACCTGAAGCCGGTCGACGACCTCCTCCTCGACTGGAGGCCCTTGTGGAAA
GAGGTCAAGGCCTGGGTTTTGCCCTCGGAGGGTCCCTCTCATCAGAGCACCCGCAGACGGGCGGCCAAGCAGCTC
CTCAAGCTCTGCACCCACGCTCACACCTACTTCGATCCTAGCCAGCGTCCGGCCGTGATAGAGAAACTGCTTCCT
TACTTTGGCGTCAACGAGCTTCCCAACGCCTTCATCGTCGTCGGCACCCTCAACGCCCTGCTGCCCAGCCATCCC
GCTCCGGCCAGCGAGCCCCTGGCCCAGCCGCAGCACTTCCTGCCGACCCTCTTCCACCTGTGGTCCATCGTGAAT
CGCTCCAAGGTGATCGATATCTTCTTCATGGACCTCTTCTCCCGCCTGACCCGCGACCACATTCACTGCCATCAC
GTTCCGTTTGGCCAGTTCGGCATCTTCACCCGGGACCAGTCGGACCTCATCTTCACCGCCATGCTCCGCCTGACG
CAGATTCCCGTCGGCCAGGCCAACTCGCCGTACACCTCGATCGATTACCTCTCGGGGGCCGGTCTCTACCTGGAA
AAGGACAAGAAAAAGTACCCTGTCGCGTACATGATGGCCCGCCTCGTCACCAGCAGCCTCTCCCCGAGTTGTCTG
GATCATCCGGACTCGATCATGTCGAGCCTTGAGGGCCTCATCGAGTCCATCGACACCTTCTTTCATCCGTCGAAC
CAAGGGTCCTGGTCTAACCTGCTGGGGCAATTCGTCCTCTACCTCACCGACGGCTTCGTTTCGCGGTGGAACCGC
GAGCAGAGCGGGGAGCTCGACATCCCGAACGGCCGCAAAATCAGCTCGCAACTGAAGAAGCGCTTCGTCCTCTCT
CTCAGGGAGGTGACCTTTATGGGCCTCTTCTCAAAGAGCAGCCGGATATCGCACTGCTACTACAACGCCCTCCAG
GGCCTGGCCTACCTGGAGCCGGACCTCGTGCTGCCCGGGGCGCTGCAGCGGTTCTACCCCAGTCTGCAAGGCCTG
GTCGAGGTCCACCGCACGACGTCGAGCTTGAACGGTCTCCAGATGATCGCCAATACCATGTGCAAGCTCAAGGGC
TATCGCTGCCACGTAACGGCCCTGCTGGCCCTCGCGCTGCCGGGCATCGACGCCAACGACCTCAACAAGACGCAG
TACACGCTCAACTTCATACAGAGCGTCGCCTACAGCGTGCCGTTCGTTTCCATGACGACCGAGGACAGCCACATC
CACGACACGACGCTGGCCATGCAGTGGGTGCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAG
ATCGACTACGCTGCCGAGCTCAGCGACGAGGACGAGACGCGGATCCTGAGGTCGTCGACGGCCGGGCTGAGCGAG
TTCGTCCTGACGCTCCTCGGCAAGATCTTCACCCTGCTGGAGAACCTGCCGGATGCCAACCAGGTCCGGGGCGGT
ACGCCGGAGGATAATGTCATCAACGCATTGCCTTCGGCGCTGTCGCCTCTGTTCGCCTCGCTGTCGCCGGACATC
TTCGACATGGCGCTCGACAAGATTGCTACTTTTGTCTCGAGCCACGTGGTGCACCAGGCTCGCGACGCCATGGCC
TGGATCCTCAACGCCCTGTGCAAGGTGGATCCGGCCAAGACGCTCAAGGTCTTCGTCCCGATGCTCGTCGTCAAC
ATTCGCAGCGAGATCGACTACAACAATGCCGCCTCGGATCGTACCACGGGCACCGACTACCTCCCCCGAGACCGG
GCTCTGGTCTGGCACATCAGCATGCTCGCCATGTGCGTCGTCCACGTCGGCGGCGAGGTGCTCAAGTACAAGGAG
GAGCTGCTGGGCATAGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATCCTCGTGTCCAACTACATC
CACCACCTGCTCCTGAACCTGACGCACACGTACCCCATCGACCACGCGCTGTACGAGCCGGACGTGCTAAAGAGG
GGGCTCGACGTCGGGGACTGGGGCAGGACGACGGCGCCGGCGGACCTCACCATCCGCTGGCACCAGCCCTCGCCG
GCCGAGGTCGAGTTCGCTGTGGAGCTTTTCGCGTCCCAGGTGACGTCTGCCACGCGGCAGCTGCAGCTCCTGATG
AGCGACAACCCGCCCGTGAGCAGGGAGGGCAAGAACAAGGCCTGGTCTGACGAGGTGTCGAGGCTCATGCAGCAA
ATGCGTCTTGCCATATCCGGCATGGCCATCATGTTTGATCCGAAGCGCGCGTCCGACGACGGCGGTAGCGACGGA
GAAGGCGGAGGCAACGCCGACGGCGACGAAGACATGATGGACGAAGACGAGATGCTGGCCGGAGACGCCGACGAG
GAGGAGGAGGAGCTCCGGCCGCAATTCCGATACCGGGCGGGTTACCCCCTGAAGCCCAAGGACCCGGTCTATCGG
CGGATACACGAGCTGCGCGACGAGATCGGCCACCTCCTGACCAGGACGCACTCGTTCCTCAACGAGAAGCAGGAA
GACGACGTCAACTGCTTCACCGCCCTGTGCTCGGCGTATCGCACGTGGATCACGGACGTGGGCATCGAGCGATCG
GCCCACCCGCTCGAGAGGCACCTGAGGCTGTACAGGGCAGACGTGGCCGCCTTCAAGATCAAGGGGCTGAGGAAG
GTCTACCCCCGGCCGCTACTGATCAAGCGGGCCGAGGCGTACCACATCCTGCGAGTTAAGCACAACGCGTCGGCA
AGGCATAAGAGCGAGCTTGACAAGCGACTCCTGCGCGACCTGGCGCACTCGTGCTTGAGCCTGTACGCCGACGTG
CGGAGGGTGGCGCAGAGCGCGCAGGACTCTTCACTCAAGTCCCTCATCGGCGGCCGGCCCATCGTGCTCCCCGTC
ATACTCGACGGCTTCCGCGCCGCCATCGAGGCCAACCAGCACGACCGGATCAAGGGCGGCATGTATACGCTGCTC
TACACGTCGCTGCTGCGGACGGTCCTCAAGGACTGGCGTTTCGCGCCCGAGGCCATGCGGCTGTACATCGAGACG
GCCGGCATCGACAAGCCGTCCATCCAGACGCTGGGCTCGACGGCGCTCTACTCCATGTTCGAGTTCGGCAAGCCT
CTCGACCGGGCCATCCTGGTGGACGACGTCGTGGTCGACTCGATCAAGCCGCCGCAGGGCGACGAGTCGGCGGCC
ATCGACAAGAGGCATCAGATGGTGGTGCAGAGGCGCAGGAAGGTCGAGGACGCCAAGTCGGCGCTCGGGCTGGAG
CTGACGCGGAGGGCAAAGGGAGCGCACTGGAAGATTGCGACTAGATGCGCCATATTTGCCGCCAACTTGTGCCTC
CGCTTCGAAGACATCGCGCCGACCGAGTTTGTGGACCTGGTGGCCCGGGGCGTCAACGACCCGCACCCCAGTCTG
AGGACCTTCTTCTTGAACTCGCTGTCGGCCCTCTTCGGCGTCATCGACATGCGGGCCGTCTACGATCACGACTAC
AACAACTACCTCCTGGAGAAGGAGATCAACGACACCAACAAGCTCGAGATAGCCGTGGCCAAGGGCGACGCCCAG
TTCACGCGCCGCTTCCTCGACGCCTTCCGGGACCCCGAGGGCGCCGAATACCTGGTCGATTCTGACCATCCGGGG
TGGCTCGCTTGGGGGAAGAGCTTCATGGCGTTTCGGGCTCGTCCCGTGCCCTTTATGGCGTACGACGAGGTCGAG
AAGGCGGTGAGGGATCAGCTTGGTAGGGTGCTGACGAGAGAGTGGTTGTCGCAGTGCTTCGACTACCTCAAGCAG
GAGCCGCGCGATCAGTGTACCGACAGATTTAGGATGCAGCACGTGTATCTGCTGATGCACGTCTTCGACCTGATG
CACTACGGCGACACGGCGGTGACGTTTGACGACGTCAAGGAGCTGACGCGCGGCATCTACGGCGACGGGAGCGAC
AAGCACCAACACCGGGCGACGTCGGAGATCTTGGGGGCGCTGCTGACCGGTTCGAGCGACGACCCGCCCGAGATC
CGGAACCGCGTATGGGGGTTTGCGGCGCCCATGCTGCTGGGAGTCCTCAGGGACGACCTGACGCCGGAGAATCTG
CAGTACTGGCTGGCGTGTCTGCACCTGGTGCTCGACGGCAAGGACCCTCGCCGTTCGCACGAGATCGTCGACGGG
CTCAAGTCGTTCCGGCTCGACATGTCGTCCAACGCGGCCTTCAAGGAGTCTTCCAAGTTGCAGCTCGTCGAATTC
ATCGTGGCCGACGGCGGGTGGCACTTTCGCGACACGGGGCCGATCCAGGAGCACCTGGTGGCGCACATCGACCAC
CCGTACAAGGCGGTGCGTGAGGCCATCGGGCGGCTGCTGTCGGCGCTGGAGAAGTCACGGTTCTACGAGGCGTTT
GAGAGCGTGCCGAGGCTGCTGGAGGAGAACAAGGCGGCGTCGTCGGTCGGCATCCGGCCGTACCAGCCGTCGCCG
GAGCTGACGGCGACCATGACGGGCATCTTTGATCGGCTGGAGCGGTGGCGGCACGAGCGGACGCCGGGGCAGCAG
ACGCCGTCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTGGACTGCACGCTGTCGTCGCACGAGTGC
GTGGAGCTGGTGCCCTTCTTCGCGACGCCCTTTGTGGAGCAGCTGCTGCACATGATGGACGTCAAGGAGGACCCG
GAGCTCATGAAGCTGGCCTACCACGTGTACCGACACCTGCCCAACATACCCTTCCGCAAGGGCGAGGACGCGGAC
CTGAGCGAGAGCCTCATCCGGGTCGGGCGGACGGCGGCGAGCTGGCACCAGAGGCTGCGGGCGCTGGTCAACATG
CAGAGCCTCTACTTCCGGCGCATCTTCATGCTCGGGGCGCCGCAGCGCGACGGGCTCTTCACCGCCGTGTCGGAC
ATGCTGAGCGACGCGCAGCTCGAGGTGCGGTCGTGCGCGTCGACGACGCTGGCGGGCATGATCCGGTGCTCGCCG
GGGCAGATACGGGGCCCCATGGTGGCGAGGCTCAAGCGGCGCTTCGAGGATGAGCTGCAGCAGAACCCGATGCCG
CGGCGGACGCAGGGCGGGACGGAGACGCCTGTGGATGTGCAGCGGCAGGTGACGAGGCGACACGCAGCGGTGCTG
GGGCTGGGGGCGCTGATTGAGGCGTTTCCGTACGCGACGCCGCCGCCCGAGTGGATGCCCGAGGTGTTGGCGATG
CTGGCGCGCAAGGCGTCGGGAGACGCGGGCGTGGTGGGCAAGGCGACCAAGGGGATCTTGAGCGAGTTCAAGAAG
ACGAGGCAGGACAGCTGGAGCGTGGATCAGAAGTACTTTACGTCGGAACAGCTCGAGGATCTGGAAGGGGTGCTG
TGGAAGAGCTACTTTGCCTGA
Gene >Ophcf2|01357
ATGGACGAAAACATTGACATATCTCACGAGGCTGCCCACGCCACCCACGTCCCTTCCATGACGTCGCATCTCGTC
AGCAGCTTCGCCGTCTTGGAGCCCGTCTCCCGCTCCACGTCGCCCGGCATTCCCTATCCCAAGACGGACGAAGAC
GACAAGAAGCGATATCGCCCTCGAACATTTGCCTATTTCCAGCAGTTGCCTTTCGAGGTCGAGGAGGAGTCGGAG
CGCGACGCCGCCCTCAATGGCATTCTCAAGCAGCTGTACATCGCCCTGCGCGCCCAGGACTACTCGCCGGGCGCT
CTGCACTGGACTCGGGAGCTCCAGGCGTGGCTCAACCTCAAGTTCGAGATGACGAGGGAGCTGAGGGCGCGGCTG
GCCCAGCTCTTCTACTCGCTCTCTCTGGCTCCCGGGCTTGATGCCAACGCGGCGGATCGCTTTCTGCGCATGGTC
ATTACGCTCACCAGGTCCGAGAAAGGATCCCCTTTGCCCAGTTCCCGCTGTCCGGAGCTGGCTAACTTTTTGTCT
TGCGATAGGAAAAATCATTACCTGAAGCCGGTCGACGACCTCCTCCTCGACTGGAGGCCCTTGTGGAAAGAGGTC
AAGGCCTGGGTTTTGCCCTCGGAGGGTCCCTCTCATCAGAGCACCCGCAGACGGGCGGCCAAGCAGCTCCTCAAG
CTCTGCACCCACGCTCACACCTACTTCGATCCTAGCCAGCGTCCGGCCGTGATAGAGAAACTGCTTCCTTACTTT
GGCGTCAACGAGCTTCCCAACGCCTTCATCGTCGTCGGCACCCTCAACGCCCTGCTGCCCAGCCATCCCGCTCCG
GCCAGCGAGCCCCTGGCCCAGCCGCAGCACTTCCTGCCGACCCTCTTCCACCTGTGGTCCATCGTGAATCGCTCC
AAGGTGATCGATATCTTCTTCATGGACCTCTTCTCCCGCCTGACCCGCGACCACATTCACTGCCATCACGTTCCG
TTTGGCCAGTTCGGCATCTTCACCCGGGACCAGTCGGACCTCATCTTCACCGCCATGCTCCGCCTGACGCAGATT
CCCGTCGGCCAGGCCAACTCGCCGTACACCTCGATCGATTACCTCTCGGGGGCCGGTCTCTACCTGGAAAAGGAC
AAGAAAAAGTACCCTGTCGCGTACATGATGGCCCGCCTCGTCACCAGCAGCCTCTCCCCGAGTTGTCTGGATCAT
CCGGACTCGATCATGTCGAGCCTTGAGGGCCTCATCGAGTCCATCGACACCTTCTTTCATCCGTCGAACCAAGGG
TCCTGGTCTAACCTGCTGGGGCAATTCGTCCTCTACCTCACCGACGGCTTCGTTTCGCGGTGGAACCGCGAGCAG
AGCGGGGAGCTCGACATCCCGAACGGCCGCAAAATCAGCTCGCAACTGAAGAAGCGCTTCGTCCTCTCTCTCAGG
GAGGTGACCTTTATGGGCCTCTTCTCAAAGAGCAGCCGGATATCGCACTGCTACTACAACGCCCTCCAGGGCCTG
GCCTACCTGGAGCCGGACCTCGTGCTGCCCGGGGCGCTGCAGCGGTTCTACCCCAGTCTGCAAGGCCTGGTCGAG
GTCCACCGCACGACGTCGAGCTTGAACGGTCTCCAGATGATCGCCAATACCATGTGCAAGCTCAAGGGCTATCGC
TGCCACGTAACGGCCCTGCTGGCCCTCGCGCTGCCGGGCATCGACGCCAACGACCTCAACAAGACGCAGTACACG
CTCAACTTCATACAGAGCGTCGCCTACAGCGTGCCGTTCGTTTCCATGACGACCGAGGACAGCCACATCCACGAC
ACGACGCTGGCCATGCAGTGGGTGCAGGCCGAGATGGACCGCATGGAGCGCGACGGCCAGAACGTCCAGATCGAC
TACGCTGCCGAGCTCAGCGACGAGGACGAGACGCGGATCCTGAGGTCGTCGACGGCCGGGCTGAGCGAGTTCGTC
CTGACGCTCCTCGGCAAGATCTTCACCCTGCTGGAGAACCTGCCGGATGCCAACCAGGTCCGGGGCGGTACGCCG
GAGGATAATGTCATCAACGCATTGCCTTCGGCGCTGTCGCCTCTGTTCGCCTCGCTGTCGCCGGACATCTTCGAC
ATGGCGCTCGACAAGATTGCTACTTTTGTCTCGAGCCACGTGGTGCACCAGGCTCGCGACGCCATGGCCTGGATC
CTCAACGCCCTGTGCAAGGTGGATCCGGCCAAGACGCTCAAGGTCTTCGTCCCGATGCTCGTCGTCAACATTCGC
AGCGAGATCGACTACAACAATGCCGCCTCGGATCGTACCACGGGCACCGACTACCTCCCCCGAGACCGGGCTCTG
GTCTGGCACATCAGCATGCTCGCCATGTGCGTCGTCCACGTCGGCGGCGAGGTGCTCAAGTACAAGGAGGAGCTG
CTGGGCATAGCCGAGTACATGCAGGACAAGTGCCGCGGCCTGCCCACCATCCTCGTGTCCAACTACATCCACCAC
CTGCTCCTGAACCTGACGCACACGTACCCCATCGACCACGCGCTGTACGAGCCGGACGTGCTAAAGAGGGGGCTC
GACGTCGGGGACTGGGGCAGGACGACGGCGCCGGCGGACCTCACCATCCGCTGGCACCAGCCCTCGCCGGCCGAG
GTCGAGTTCGCTGTGGAGCTTTTCGCGTCCCAGGTGACGTCTGCCACGCGGCAGCTGCAGCTCCTGATGAGCGAC
AACCCGCCCGTGAGCAGGGAGGGCAAGAACAAGGCCTGGTCTGACGAGGTGTCGAGGCTCATGCAGCAAATGCGT
CTTGCCATATCCGGCATGGCCATCATGTTTGATCCGAAGCGCGCGTCCGACGACGGCGGTAGCGACGGAGAAGGC
GGAGGCAACGCCGACGGCGACGAAGACATGATGGACGAAGACGAGATGCTGGCCGGAGACGCCGACGAGGAGGAG
GAGGAGCTCCGGCCGCAATTCCGATACCGGGCGGGTTACCCCCTGAAGCCCAAGGACCCGGTCTATCGGCGGATA
CACGAGCTGCGCGACGAGATCGGCCACCTCCTGACCAGGACGCACTCGTTCCTCAACGAGAAGCAGGAAGACGAC
GTCAACTGCTTCACCGCCCTGTGCTCGGCGTATCGCACGTGGATCACGGACGTGGGCATCGAGCGATCGGCCCAC
CCGCTCGAGAGGCACCTGAGGCTGTACAGGGCAGACGTGGCCGCCTTCAAGATCAAGGGGCTGAGGAAGGTCTAC
CCCCGGCCGCTACTGATCAAGCGGGCCGAGGCGTACCACATCCTGCGAGTTAAGCACAACGCGTCGGCAAGGCAT
AAGAGCGAGCTTGACAAGCGACTCCTGCGCGACCTGGCGCACTCGTGCTTGAGCCTGTACGCCGACGTGCGGAGG
GTGGCGCAGAGCGCGCAGGACTCTTCACTCAAGTCCCTCATCGGCGGCCGGCCCATCGTGCTCCCCGTCATACTC
GACGGCTTCCGCGCCGCCATCGAGGCCAACCAGCACGACCGGATCAAGGGCGGCATGTATACGCTGCTCTACACG
TCGCTGCTGCGGACGGTCCTCAAGGACTGGCGTTTCGCGCCCGAGGCCATGCGGCTGTACATCGAGACGGCCGGC
ATCGACAAGCCGTCCATCCAGACGCTGGGCTCGACGGCGCTCTACTCCATGTTCGAGTTCGGCAAGCCTCTCGAC
CGGGCCATCCTGGTGGACGACGTCGTGGTCGACTCGATCAAGCCGCCGCAGGGCGACGAGTCGGCGGCCATCGAC
AAGAGGCATCAGATGGTGGTGCAGAGGCGCAGGAAGGTCGAGGACGCCAAGTCGGCGCTCGGGCTGGAGCTGACG
CGGAGGGCAAAGGGAGCGCACTGGAAGATTGCGACTAGATGCGCCATATTTGCCGCCAACTTGTGCCTCCGCTTC
GAAGACATCGCGCCGACCGAGTTTGTGGACCTGGTGGCCCGGGGCGTCAACGACCCGCACCCCAGTCTGAGGACC
TTCTTCTTGAACTCGCTGTCGGCCCTCTTCGGCGTCATCGACATGCGGGCCGTCTACGATCACGACTACAACAAC
TACCTCCTGGAGAAGGAGATCAACGACACCAACAAGCTCGAGATAGCCGTGGCCAAGGGCGACGCCCAGTTCACG
CGCCGCTTCCTCGACGCCTTCCGGGACCCCGAGGGCGCCGAATACCTGGTCGATTCTGACCATCCGGGGTGGCTC
GCTTGGGGGAAGAGCTTCATGGCGTTTCGGGCTCGTCCCGTGCCCTTTATGGCGTACGACGAGGTCGAGAAGGCG
GTGAGGGATCAGCTTGGTAGGGTGCTGACGAGAGAGTGGTTGTCGCAGTGCTTCGACTACCTCAAGCAGGAGCCG
CGCGATCAGTGTACCGACAGATTTAGGATGCAGCACGTGTATCTGCTGATGCACGTCTTCGACCTGATGCACTAC
GGCGACACGGCGGTGACGTTTGACGACGTCAAGGAGCTGACGCGCGGCATCTACGGCGACGGGAGCGACAAGCAC
CAACACCGGGCGACGTCGGAGATCTTGGGGGCGCTGCTGACCGGTTCGAGCGACGACCCGCCCGAGATCCGGAAC
CGCGTATGGGGGTTTGCGGCGCCCATGCTGCTGGGAGTCCTCAGGGACGACCTGACGCCGGAGAATCTGCAGTAC
TGGCTGGCGTGTCTGCACCTGGTGCTCGACGGCAAGGACCCTCGCCGTTCGCACGAGATCGTCGACGGGCTCAAG
TCGTTCCGGCTCGACATGTCGTCCAACGCGGCCTTCAAGGAGTCTTCCAAGTTGCAGCTCGTCGAATTCATCGTG
GCCGACGGCGGGTGGCACTTTCGCGACACGGGGCCGATCCAGGAGCACCTGGTGGCGCACATCGACCACCCGTAC
AAGGCGGTGCGTGAGGCCATCGGGCGGCTGCTGTCGGCGCTGGAGAAGTCACGGTTCTACGAGGCGTTTGAGAGC
GTGCCGAGGCTGCTGGAGGAGAACAAGGCGGCGTCGTCGGTCGGCATCCGGCCGTACCAGCCGTCGCCGGAGCTG
ACGGCGACCATGACGGGCATCTTTGATCGGCTGGAGCGGTGGCGGCACGAGCGGACGCCGGGGCAGCAGACGCCG
TCGTCGTACACGTCCGGGTCCAAGACGGTGCTCATGTGGCTGGACTGCACGCTGTCGTCGCACGAGTGCGTGGAG
CTGGTGCCCTTCTTCGCGACGCCCTTTGTGGAGCAGCTGCTGCACATGATGGACGTCAAGGAGGACCCGGAGCTC
ATGAAGCTGGCCTACCACGTGTACCGACACCTGCCCAACATACCCTTCCGCAAGGGCGAGGACGCGGACCTGAGC
GAGAGCCTCATCCGGGTCGGGCGGACGGCGGCGAGCTGGCACCAGAGGCTGCGGGCGCTGGTCAACATGCAGAGC
CTCTACTTCCGGCGCATCTTCATGCTCGGGGCGCCGCAGCGCGACGGGCTCTTCACCGCCGTGTCGGACATGCTG
AGCGACGCGCAGCTCGAGGTGCGGTCGTGCGCGTCGACGACGCTGGCGGGCATGATCCGGTGCTCGCCGGGGCAG
ATACGGGGCCCCATGGTGGCGAGGCTCAAGCGGCGCTTCGAGGATGAGCTGCAGCAGAACCCGATGCCGCGGCGG
ACGCAGGGCGGGACGGAGACGCCTGTGGATGTGCAGCGGCAGGTGACGAGGCGACACGCAGCGGTGCTGGGGCTG
GGGGCGCTGATTGAGGCGTTTCCGTACGCGACGCCGCCGCCCGAGTGGATGCCCGAGGTGTTGGCGATGCTGGCG
CGCAAGGCGTCGGGAGACGCGGGCGTGGTGGGCAAGGCGACCAAGGGGATCTTGAGCGAGTTCAAGAAGACGAGG
CAGGACAGCTGGAGCGTGGATCAGAAGGTGAGTGGACGAATGGTGGTGGTGGTGATGATGATGATGATGAGTGAA
CGAGTGAGTGATTATCATGCTGACTTGATGGTCTCTGCAGTACTTTACGTCGGAACAGCTCGAGGATCTGGAAGG
GGTGCTGTGGAAGAGCTACTTTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail