Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01356
Gene name
Locationscaffold_01:4776971..4778911
Strand-
Gene length (bp)1940
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00962 A_deaminase Adenosine deaminase 4.8E-31 218 523

GO

GO Term Description Terminal node
GO:0019239 deaminase activity Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7088 0.4068 0.0508 0.1865 0.1168 0.078 0.037 0.4178 0.1576 0.0386

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup925
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7718
Ophiocordyceps australis map64 (Brazil) OphauB2|1318
Ophiocordyceps australis map64 (Brazil) OphauB2|2631
Ophiocordyceps camponoti-floridani Ophcf2|01356 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5543
Ophiocordyceps kimflemingae Ophio5|7755
Ophiocordyceps subramaniannii Hirsu2|6461

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01356
MDPVSAHNDVNAYRAARTRLLDSERASAFDARCRARASPVEVRANRVLAAVRRRDETDVYGAAKPRLGHGGQTHR
RFAGDRFLSSLDLIRGTALMDVARRLPKGGHLHVHFNACLPPRSLLDMAKGMDRMFVTSDVALVPDDDYASFHRC
QLQFSIIGPGEEREGDVFAPDYVPRSTMSFARFLEAFPRHYPQASPDDWLEKKLVFSPEEAYGPLQTSEGAWDMF
NGRTRMMKGLFSYESAYRRYTRLFLEDLVRDGILYAEVRPNFMSSNQLYRDDGSGLIDNKGIMRIIIDVVTAFRA
ELDTDCRRFAGLKVIYCTPRVFSSRDIEAALDECLVFKKLWPEWIAGFDLVGEESKGRPLKHFTAEFLAFKRKCA
DQGLEIPFLFHCGETLEVGTETDENLVDALLLGAKRIGHGFALPRHPLVMQRMKDQGVCLELCPISNEVLGLTPR
IAGHALYTLLANDVPCTLNSDNGALFRSTLSHDFYQVMVGKADLDLFGWKQLALWSIHHACLDASEKETVMSRWE
AQWDEFLAWLLERPKGADVVS*
Coding >Ophcf2|01356
ATGGACCCCGTCAGCGCCCACAACGACGTCAATGCCTACCGCGCCGCCCGCACCCGTCTCCTCGACAGCGAGCGA
GCCTCAGCCTTTGACGCCCGCTGTCGCGCCCGAGCCTCGCCGGTCGAGGTCCGCGCCAACCGGGTTCTCGCCGCC
GTTCGCCGGCGCGACGAGACCGACGTCTACGGCGCTGCCAAGCCTCGCCTCGGCCACGGCGGTCAGACGCACCGC
CGCTTCGCCGGAGATCGCTTCCTATCGAGCCTCGATCTTATCCGGGGAACTGCCCTCATGGACGTCGCCAGGCGT
CTGCCCAAAGGCGGCCACCTTCACGTGCACTTCAACGCCTGTCTGCCGCCCCGGTCGCTGCTGGATATGGCAAAG
GGCATGGACCGCATGTTCGTCACCAGCGATGTTGCTCTCGTGCCGGATGACGATTACGCCAGCTTTCATCGCTGT
CAGCTGCAATTCTCCATCATCGGTCCGGGCGAGGAGCGCGAGGGTGACGTGTTTGCGCCCGATTATGTGCCCCGG
AGTACCATGAGCTTTGCTCGCTTCTTGGAGGCGTTTCCTCGACACTATCCGCAGGCGTCGCCGGATGACTGGCTG
GAGAAGAAGCTCGTCTTCAGCCCCGAGGAGGCTTACGGGCCGCTGCAGACGTCGGAAGGCGCCTGGGACATGTTC
AACGGCCGGACGCGCATGATGAAGGGCCTCTTCAGCTACGAGTCGGCCTATCGTCGGTATACGCGCCTCTTCCTT
GAGGACCTGGTCCGCGACGGTATCCTCTACGCCGAGGTCCGCCCCAACTTCATGAGCAGCAACCAGCTGTATCGC
GACGACGGCTCGGGTCTCATCGACAACAAGGGCATCATGCGTATCATCATCGACGTCGTCACTGCCTTCCGGGCT
GAGCTCGACACCGATTGCCGTCGCTTCGCCGGCCTCAAGGTCATCTACTGCACGCCCCGCGTCTTTTCCTCTCGC
GATATCGAAGCTGCGCTCGACGAGTGCCTCGTGTTTAAGAAACTTTGGCCAGAGTGGATAGCAGGCTTCGATCTC
GTGGGAGAGGAGTCCAAAGGCAGACCCCTGAAGCACTTCACCGCCGAGTTTCTCGCCTTCAAGCGCAAGTGCGCA
GACCAAGGCCTCGAAATCCCCTTTCTCTTTCACTGCGGCGAGACGCTCGAGGTCGGCACCGAGACGGACGAGAAC
CTGGTTGACGCCCTCCTCCTGGGCGCCAAGCGCATCGGTCACGGCTTCGCCCTCCCGCGCCACCCGCTCGTCATG
CAGCGAATGAAGGATCAGGGCGTCTGTCTCGAGTTGTGTCCCATCTCCAACGAGGTGCTGGGCCTGACGCCGCGT
ATCGCCGGCCACGCGCTGTACACGCTCCTGGCAAACGACGTGCCCTGCACCCTCAACTCTGACAATGGGGCCCTG
TTCCGATCGACGCTCTCGCACGACTTTTACCAGGTCATGGTGGGGAAAGCAGACCTTGACCTCTTCGGCTGGAAG
CAGCTGGCCCTCTGGAGCATCCATCACGCCTGTCTTGATGCATCGGAGAAGGAGACGGTGATGAGCAGATGGGAG
GCTCAGTGGGATGAGTTTTTGGCCTGGTTGCTGGAACGGCCCAAAGGTGCTGACGTGGTGTCATGA
Transcript >Ophcf2|01356
ATGGACCCCGTCAGCGCCCACAACGACGTCAATGCCTACCGCGCCGCCCGCACCCGTCTCCTCGACAGCGAGCGA
GCCTCAGCCTTTGACGCCCGCTGTCGCGCCCGAGCCTCGCCGGTCGAGGTCCGCGCCAACCGGGTTCTCGCCGCC
GTTCGCCGGCGCGACGAGACCGACGTCTACGGCGCTGCCAAGCCTCGCCTCGGCCACGGCGGTCAGACGCACCGC
CGCTTCGCCGGAGATCGCTTCCTATCGAGCCTCGATCTTATCCGGGGAACTGCCCTCATGGACGTCGCCAGGCGT
CTGCCCAAAGGCGGCCACCTTCACGTGCACTTCAACGCCTGTCTGCCGCCCCGGTCGCTGCTGGATATGGCAAAG
GGCATGGACCGCATGTTCGTCACCAGCGATGTTGCTCTCGTGCCGGATGACGATTACGCCAGCTTTCATCGCTGT
CAGCTGCAATTCTCCATCATCGGTCCGGGCGAGGAGCGCGAGGGTGACGTGTTTGCGCCCGATTATGTGCCCCGG
AGTACCATGAGCTTTGCTCGCTTCTTGGAGGCGTTTCCTCGACACTATCCGCAGGCGTCGCCGGATGACTGGCTG
GAGAAGAAGCTCGTCTTCAGCCCCGAGGAGGCTTACGGGCCGCTGCAGACGTCGGAAGGCGCCTGGGACATGTTC
AACGGCCGGACGCGCATGATGAAGGGCCTCTTCAGCTACGAGTCGGCCTATCGTCGGTATACGCGCCTCTTCCTT
GAGGACCTGGTCCGCGACGGTATCCTCTACGCCGAGGTCCGCCCCAACTTCATGAGCAGCAACCAGCTGTATCGC
GACGACGGCTCGGGTCTCATCGACAACAAGGGCATCATGCGTATCATCATCGACGTCGTCACTGCCTTCCGGGCT
GAGCTCGACACCGATTGCCGTCGCTTCGCCGGCCTCAAGGTCATCTACTGCACGCCCCGCGTCTTTTCCTCTCGC
GATATCGAAGCTGCGCTCGACGAGTGCCTCGTGTTTAAGAAACTTTGGCCAGAGTGGATAGCAGGCTTCGATCTC
GTGGGAGAGGAGTCCAAAGGCAGACCCCTGAAGCACTTCACCGCCGAGTTTCTCGCCTTCAAGCGCAAGTGCGCA
GACCAAGGCCTCGAAATCCCCTTTCTCTTTCACTGCGGCGAGACGCTCGAGGTCGGCACCGAGACGGACGAGAAC
CTGGTTGACGCCCTCCTCCTGGGCGCCAAGCGCATCGGTCACGGCTTCGCCCTCCCGCGCCACCCGCTCGTCATG
CAGCGAATGAAGGATCAGGGCGTCTGTCTCGAGTTGTGTCCCATCTCCAACGAGGTGCTGGGCCTGACGCCGCGT
ATCGCCGGCCACGCGCTGTACACGCTCCTGGCAAACGACGTGCCCTGCACCCTCAACTCTGACAATGGGGCCCTG
TTCCGATCGACGCTCTCGCACGACTTTTACCAGGTCATGGTGGGGAAAGCAGACCTTGACCTCTTCGGCTGGAAG
CAGCTGGCCCTCTGGAGCATCCATCACGCCTGTCTTGATGCATCGGAGAAGGAGACGGTGATGAGCAGATGGGAG
GCTCAGTGGGATGAGTTTTTGGCCTGGTTGCTGGAACGGCCCAAAGGTGCTGACGTGGTGTCATGA
Gene >Ophcf2|01356
ATGGACCCCGTCAGCGCCCACAACGACGTCAATGCCTACCGCGCCGCCCGCACCCGTCTCCTCGACAGCGAGCGA
GCCTCAGCCTTTGACGCCCGCTGTCGCGCCCGAGCCTCGCCGGTCGAGGTCCGCGCCAACCGGGTTCTCGCCGCC
GTTCGCCGGCGCGACGAGACCGACGTCTACGGCGCTGCCAAGCCTCGCCTCGGCCACGGCGGTCAGACGCACCGC
CGCTTCGCCGGAGATCGCTTCCTATCGAGCCTCGATCTTATCCGGGGAACTGCCCTCATGGACGTCGCCAGGCGT
CTGCCCAAAGGCGGCCACCTTCACGTGCACTTCAACGCCTGTCTGCCGCCCCGGTCGCTGCTGGATATGGCAAAG
GGCATGGACCGCATGTTCGTCACCAGCGATGTTGCTCTCGTGCCGGATGACGATTACGCCAGCTTTCATCGCTGT
CAGCTGCAATTCTCCATCATCGGTCCGGGCGAGGAGCGCGAGGGTGACGTGTTTGCGCCCGATTATGTGCCCCGG
AGTACCATGAGCTTTGCTCGCTTCTTGGAGGCGTTTCCTCGACACTATCCGCAGGCGTCGCCGGATGACTGGCTG
GAGAAGAAGCTCGTCTTCAGCCCCGAGGAGGCTTACGGGCCGCTGCAGACGTCGGAAGGGTTCACCTCTCCGCTC
TCTCTTGGTTTGAAGGCCGAGTCCCTGACTTTTCATGGCCCCTCTGCTTTCACAGCGCCTGGGACATGTTCAACG
GCCGGACGCGCATGATGAAGGGCCTCTTCAGCTACGAGTCGGCCTATCGTCGGTATACGCGCCTCTTCCTTGAGG
ACCTGGTCCGCGACGGTATCCTCTACGCCGAGGTCCGCCCCAACTTCATGAGCAGCAACCAGCTGTATCGCGACG
ACGGCTCGGGTCTCATCGACAACAAGGGCATCATGCGTATCATCATCGACGTCGTCACTGCCTTCCGGGCTGAGC
TCGACACCGATTGCCGTCGCTTCGCCGGCCTCAAGGTCATCTACTGCACGCCCCGCGTCTTTTCCTCTCGCGATA
TCGAAGCTGCGCTCGACGAGTGCCTCGTGTTTAAGAAACTTTGGCCAGAGTGGATAGCAGGTGAGCTTCACATCA
CACCTACAATATACATATATCTTGTATCTGCGTTGACGGGGCTTGCATTAGGCTTCGATCTCGTGGGAGAGGAGT
CCAAAGGCAGACCCCTGAAGCACTTCACCGCCGAGTTTCTCGCCTTCAAGCGCAAGTGCGCAGACCAAGGCCTCG
AAATCCCCTTTCTCTTTCACTGCGGCGAGACGCTCGAGGTCGGCACCGAGACGGACGAGAACCTGGTTGACGCCC
TCCTCCTGGGCGCCAAGCGCATCGGTCACGGCTTCGCCCTCCCGCGCCACCCGCTCGTCATGCAGCGAATGAAGG
ATCAGGGCGTCTGTCTCGAGTTGTGTCCCATCTCCAACGAGGTGCTGGGCCTGACGCCGCGTATCGCCGGCCACG
CGCTGTACACGCTCCTGGCAAACGACGTGCCCTGCACCCTCAACTCTGACAATGGGGCCCTGTTCCGGTTTGTTT
CTTTACCTCTCGGTCTTGGTATTGATGTTTGGTTTTGTAACCTTTTTGTCTAGATCGACGCTCTCGCACGACTTT
TACCAGGTCATGGTGGGGAAAGCAGACCTTGACCTCTTCGGCTGGAAGCAGCTGGCCCTCTGGAGCATCCATCAC
GCCTGTCTTGATGCATCGGAGAAGGAGACGGTGATGAGCAGATGGGAGGCTCAGTGGGATGAGTTTTTGGCCTGG
TTGCTGGAACGGTATGGCGATTGGGCTGACGGGGAAGGGGGACGAGGGGTCTGAGACGTGACGGAAGGCCCAAAG
GTGAGTTGGATGGGGTGCTTCGTCAAGGTGCTGATGTGGTGTAAGGTGCTGACGTGGTGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail