Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01350
Gene name
Locationscaffold_01:4761554..4763177
Strand-
Gene length (bp)1623
Transcript length (bp)1560
Coding sequence length (bp)1560
Protein length (aa) 520

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12756 zf-C2H2_2 C2H2 type zinc-finger (2 copies) 1.3E-27 201 297
PF12874 zf-met Zinc-finger of C2H2 type 5.3E-05 77 100
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 2.5E-05 78 101

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.532 0.7239 0.0179 0.0206 0.1616 0.0044 0.1128 0.0745 0.0463 0.0055

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup929
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1995
Ophiocordyceps australis map64 (Brazil) OphauB2|7267
Ophiocordyceps camponoti-floridani Ophcf2|01350 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2366
Ophiocordyceps kimflemingae Ophio5|7595
Ophiocordyceps subramaniannii Hirsu2|6592

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01350
MATADTGSHPYTCNTCQVAYRNIDLQKGHMKSDWHRYNLKRRVASLPPIASTAFTDKVLQARAATTAEADKALFE
RTCEACVKTYYSENAYRNHLLSQKHRQSQAARHPGDDEVTSVVSSTFSLGEPPTDKVGSDAEHEFNQVIESLQKT
TVSQQRPSPVKRPSNPQPVGGDDEDVNGQGASADGSLTVAGSEPSWTPKSCIFCNYSSPTVSLNVSHMERFHGMF
IPEKPYLVDVEGLVVHLQNQVGRHHQCLSCGKIKSTVFAVQTHMRDKSHCTIPFSSEQEQLRIGDFYDFRSTYSD
GDMSDDEPDVKPDGAKLGSKRPTQLILGPDGRQMGDDDDGDGWETDSSVSSLDSADLTSVPAEAHHPRAHRSTHA
VFHDDHELYLPSGRAVGHRSLNRYYRQNLERYSGPEDRVEAAAGEGTVEGAVVKTGPDGEEADLVARADGHRQPV
VRASSDRRQLLPRGGVGMAGVSDDKRRLVRKEERRGRDAQRQRERNNEWAYSKRANNQKTYYYRYDGGG*
Coding >Ophcf2|01350
ATGGCCACCGCCGACACCGGCTCGCATCCCTACACATGCAACACATGCCAGGTCGCCTACCGTAACATAGACCTG
CAAAAGGGTCACATGAAGAGTGACTGGCACCGGTATAATCTGAAACGCCGCGTCGCCTCCCTGCCTCCCATCGCC
TCGACCGCCTTCACCGACAAAGTTCTCCAGGCCCGGGCCGCCACCACGGCCGAGGCCGACAAGGCTCTCTTTGAG
CGCACCTGCGAAGCCTGCGTCAAGACGTACTACAGCGAGAATGCCTATCGCAACCACCTGCTCAGCCAGAAACAC
AGGCAAAGTCAGGCCGCTCGCCATCCCGGAGACGATGAGGTCACCTCGGTCGTCAGCTCGACCTTCTCCCTCGGC
GAGCCCCCTACCGATAAAGTTGGTAGCGACGCCGAGCACGAGTTCAACCAGGTCATCGAGAGCCTGCAGAAAACT
ACCGTGTCCCAACAGCGGCCCTCTCCCGTCAAGCGACCTTCGAACCCGCAACCCGTCGGTGGCGATGACGAAGAT
GTCAACGGCCAAGGCGCCTCGGCCGATGGTTCTCTCACCGTGGCGGGCTCCGAGCCGTCATGGACGCCAAAGTCG
TGTATCTTCTGCAACTACTCGTCGCCGACGGTGTCTCTCAACGTCAGCCACATGGAGCGCTTTCACGGCATGTTC
ATACCCGAGAAGCCATACCTCGTAGACGTCGAGGGCCTCGTTGTACACCTCCAGAATCAGGTCGGCCGGCATCAT
CAGTGCCTGAGCTGCGGCAAGATCAAGTCGACGGTTTTCGCCGTTCAGACGCACATGCGCGACAAGAGCCACTGC
ACGATACCCTTCTCATCCGAGCAGGAGCAGCTCCGAATCGGAGACTTTTACGACTTCCGTAGCACCTACTCGGAC
GGCGATATGTCCGATGATGAGCCCGACGTGAAGCCCGACGGGGCAAAGCTGGGCTCCAAACGGCCCACCCAGCTG
ATTCTTGGACCCGACGGCCGACAGATGGGTGACGACGATGACGGCGACGGCTGGGAGACGGACAGTTCCGTCTCG
TCCCTCGACTCGGCCGACCTGACGAGCGTACCGGCCGAGGCTCACCACCCGCGAGCTCACCGCTCCACGCACGCC
GTCTTCCACGACGACCATGAGCTCTATCTGCCATCGGGCAGGGCGGTGGGCCACCGCTCGCTCAATCGCTACTAT
CGGCAGAATCTAGAACGGTACTCAGGTCCGGAGGATCGGGTCGAGGCGGCTGCCGGTGAGGGCACTGTCGAGGGG
GCAGTCGTCAAGACCGGGCCCGACGGTGAAGAGGCGGATCTCGTCGCCAGGGCCGATGGCCACAGGCAGCCCGTG
GTGCGGGCCAGCTCGGATCGGCGTCAGCTGCTTCCGCGCGGCGGTGTCGGCATGGCGGGCGTCTCGGACGACAAG
AGGCGGCTGGTTCGCAAGGAGGAGCGGCGCGGGCGCGATGCCCAGAGGCAGCGAGAAAGGAACAATGAATGGGCG
TACAGCAAACGGGCCAATAACCAAAAGACCTACTACTACCGCTACGACGGTGGCGGCTAG
Transcript >Ophcf2|01350
ATGGCCACCGCCGACACCGGCTCGCATCCCTACACATGCAACACATGCCAGGTCGCCTACCGTAACATAGACCTG
CAAAAGGGTCACATGAAGAGTGACTGGCACCGGTATAATCTGAAACGCCGCGTCGCCTCCCTGCCTCCCATCGCC
TCGACCGCCTTCACCGACAAAGTTCTCCAGGCCCGGGCCGCCACCACGGCCGAGGCCGACAAGGCTCTCTTTGAG
CGCACCTGCGAAGCCTGCGTCAAGACGTACTACAGCGAGAATGCCTATCGCAACCACCTGCTCAGCCAGAAACAC
AGGCAAAGTCAGGCCGCTCGCCATCCCGGAGACGATGAGGTCACCTCGGTCGTCAGCTCGACCTTCTCCCTCGGC
GAGCCCCCTACCGATAAAGTTGGTAGCGACGCCGAGCACGAGTTCAACCAGGTCATCGAGAGCCTGCAGAAAACT
ACCGTGTCCCAACAGCGGCCCTCTCCCGTCAAGCGACCTTCGAACCCGCAACCCGTCGGTGGCGATGACGAAGAT
GTCAACGGCCAAGGCGCCTCGGCCGATGGTTCTCTCACCGTGGCGGGCTCCGAGCCGTCATGGACGCCAAAGTCG
TGTATCTTCTGCAACTACTCGTCGCCGACGGTGTCTCTCAACGTCAGCCACATGGAGCGCTTTCACGGCATGTTC
ATACCCGAGAAGCCATACCTCGTAGACGTCGAGGGCCTCGTTGTACACCTCCAGAATCAGGTCGGCCGGCATCAT
CAGTGCCTGAGCTGCGGCAAGATCAAGTCGACGGTTTTCGCCGTTCAGACGCACATGCGCGACAAGAGCCACTGC
ACGATACCCTTCTCATCCGAGCAGGAGCAGCTCCGAATCGGAGACTTTTACGACTTCCGTAGCACCTACTCGGAC
GGCGATATGTCCGATGATGAGCCCGACGTGAAGCCCGACGGGGCAAAGCTGGGCTCCAAACGGCCCACCCAGCTG
ATTCTTGGACCCGACGGCCGACAGATGGGTGACGACGATGACGGCGACGGCTGGGAGACGGACAGTTCCGTCTCG
TCCCTCGACTCGGCCGACCTGACGAGCGTACCGGCCGAGGCTCACCACCCGCGAGCTCACCGCTCCACGCACGCC
GTCTTCCACGACGACCATGAGCTCTATCTGCCATCGGGCAGGGCGGTGGGCCACCGCTCGCTCAATCGCTACTAT
CGGCAGAATCTAGAACGGTACTCAGGTCCGGAGGATCGGGTCGAGGCGGCTGCCGGTGAGGGCACTGTCGAGGGG
GCAGTCGTCAAGACCGGGCCCGACGGTGAAGAGGCGGATCTCGTCGCCAGGGCCGATGGCCACAGGCAGCCCGTG
GTGCGGGCCAGCTCGGATCGGCGTCAGCTGCTTCCGCGCGGCGGTGTCGGCATGGCGGGCGTCTCGGACGACAAG
AGGCGGCTGGTTCGCAAGGAGGAGCGGCGCGGGCGCGATGCCCAGAGGCAGCGAGAAAGGAACAATGAATGGGCG
TACAGCAAACGGGCCAATAACCAAAAGACCTACTACTACCGCTACGACGGTGGCGGCTAG
Gene >Ophcf2|01350
ATGGCCACCGCCGACACCGGCTCGCATCCCTACACATGCAACACATGCCAGGTCGCCTACCGTAACATAGACCTG
CAAAAGGGTCACATGAAGAGTGACTGGCAGTGAGTCGTGTCCCGGCTCGCCTTGTCGTGTTACCAGTTGGCAAGT
TGCTAACCATGGCCCAGCCGGTATAATCTGAAACGCCGCGTCGCCTCCCTGCCTCCCATCGCCTCGACCGCCTTC
ACCGACAAAGTTCTCCAGGCCCGGGCCGCCACCACGGCCGAGGCCGACAAGGCTCTCTTTGAGCGCACCTGCGAA
GCCTGCGTCAAGACGTACTACAGCGAGAATGCCTATCGCAACCACCTGCTCAGCCAGAAACACAGGCAAAGTCAG
GCCGCTCGCCATCCCGGAGACGATGAGGTCACCTCGGTCGTCAGCTCGACCTTCTCCCTCGGCGAGCCCCCTACC
GATAAAGTTGGTAGCGACGCCGAGCACGAGTTCAACCAGGTCATCGAGAGCCTGCAGAAAACTACCGTGTCCCAA
CAGCGGCCCTCTCCCGTCAAGCGACCTTCGAACCCGCAACCCGTCGGTGGCGATGACGAAGATGTCAACGGCCAA
GGCGCCTCGGCCGATGGTTCTCTCACCGTGGCGGGCTCCGAGCCGTCATGGACGCCAAAGTCGTGTATCTTCTGC
AACTACTCGTCGCCGACGGTGTCTCTCAACGTCAGCCACATGGAGCGCTTTCACGGCATGTTCATACCCGAGAAG
CCATACCTCGTAGACGTCGAGGGCCTCGTTGTACACCTCCAGAATCAGGTCGGCCGGCATCATCAGTGCCTGAGC
TGCGGCAAGATCAAGTCGACGGTTTTCGCCGTTCAGACGCACATGCGCGACAAGAGCCACTGCACGATACCCTTC
TCATCCGAGCAGGAGCAGCTCCGAATCGGAGACTTTTACGACTTCCGTAGCACCTACTCGGACGGCGATATGTCC
GATGATGAGCCCGACGTGAAGCCCGACGGGGCAAAGCTGGGCTCCAAACGGCCCACCCAGCTGATTCTTGGACCC
GACGGCCGACAGATGGGTGACGACGATGACGGCGACGGCTGGGAGACGGACAGTTCCGTCTCGTCCCTCGACTCG
GCCGACCTGACGAGCGTACCGGCCGAGGCTCACCACCCGCGAGCTCACCGCTCCACGCACGCCGTCTTCCACGAC
GACCATGAGCTCTATCTGCCATCGGGCAGGGCGGTGGGCCACCGCTCGCTCAATCGCTACTATCGGCAGAATCTA
GAACGGTACTCAGGTCCGGAGGATCGGGTCGAGGCGGCTGCCGGTGAGGGCACTGTCGAGGGGGCAGTCGTCAAG
ACCGGGCCCGACGGTGAAGAGGCGGATCTCGTCGCCAGGGCCGATGGCCACAGGCAGCCCGTGGTGCGGGCCAGC
TCGGATCGGCGTCAGCTGCTTCCGCGCGGCGGTGTCGGCATGGCGGGCGTCTCGGACGACAAGAGGCGGCTGGTT
CGCAAGGAGGAGCGGCGCGGGCGCGATGCCCAGAGGCAGCGAGAAAGGAACAATGAATGGGCGTACAGCAAACGG
GCCAATAACCAAAAGACCTACTACTACCGCTACGACGGTGGCGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail