Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01349
Gene name
Locationscaffold_01:4760364..4761465
Strand+
Gene length (bp)1101
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.1E-40 6 187
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.6E-29 15 188
PF08659 KR KR domain 2.2E-06 6 165

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 12.27 4.33 20.22
Alive In ants, during behavior modification 19.83 8.18 31.47
Dead In ants, recently dead 17.37 6.95 27.78

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.068148 no
Alive Dead 0.604322 no
Dead Fungus 0.215630 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01349
MARKTTVLITGCSPGGIGHALALEFHRRGCHVIATARRPEVLVGLDSMGISTLQLDVTDDESVARCRDEARALLV
DGKLDVLVNNAGSFHVAAALDDEMESAKAMFDVNVFGVMRMCKVFVDLLIPARGLIVNVSSVLAIMPLILTSVYS
SSKAALDQYTAVLRRELEPFHVRIMLIQAGGVKTCISRDGGYTLPTNSRYAVARDVYDLFANNLQKVMSMPADRF
AARVVGAALGEPRLGGLLGGTPDRLWKGNLSFVTWVYQLSFVPTWVRRLILNAIDKNYRMTWLIQEAHSRDKLHQ
P*
Coding >Ophcf2|01349
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTGTTCACCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTC
CATAGGCGCGGATGTCACGTCATTGCCACCGCCCGCCGGCCCGAGGTGCTCGTCGGACTGGACTCGATGGGTATC
AGCACCCTCCAGCTGGATGTTACAGACGACGAGAGCGTGGCTCGATGCCGAGACGAGGCCAGGGCCCTACTGGTG
GACGGCAAGCTCGACGTGTTGGTCAACAATGCGGGTTCTTTTCACGTAGCAGCCGCCCTCGACGATGAAATGGAA
TCGGCCAAGGCCATGTTCGACGTCAACGTCTTCGGCGTGATGCGCATGTGCAAGGTCTTTGTCGACTTGCTCATC
CCAGCCCGCGGCCTCATCGTCAACGTGTCATCCGTCCTCGCCATCATGCCCCTCATCTTAACCAGCGTGTACTCT
TCTAGCAAGGCGGCCCTCGACCAATACACGGCAGTGCTGCGTCGGGAACTGGAGCCCTTTCACGTCCGCATCATG
CTGATCCAGGCCGGCGGTGTCAAAACCTGCATCTCGCGAGATGGTGGTTATACTCTTCCGACCAACTCGCGCTAC
GCTGTCGCTCGTGACGTCTACGACTTGTTTGCCAACAACCTGCAGAAAGTCATGAGCATGCCCGCGGATCGCTTT
GCTGCTCGCGTCGTCGGCGCTGCCCTGGGCGAGCCGCGGCTAGGCGGTCTGCTCGGAGGCACGCCTGATCGTCTC
TGGAAGGGTAACTTGTCCTTTGTTACTTGGGTCTACCAACTTAGTTTTGTCCCTACCTGGGTTCGACGTCTTATT
CTCAACGCCATCGACAAAAACTACCGAATGACGTGGCTGATTCAAGAGGCCCATTCGCGGGACAAGCTGCATCAA
CCATAG
Transcript >Ophcf2|01349
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTGTTCACCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTC
CATAGGCGCGGATGTCACGTCATTGCCACCGCCCGCCGGCCCGAGGTGCTCGTCGGACTGGACTCGATGGGTATC
AGCACCCTCCAGCTGGATGTTACAGACGACGAGAGCGTGGCTCGATGCCGAGACGAGGCCAGGGCCCTACTGGTG
GACGGCAAGCTCGACGTGTTGGTCAACAATGCGGGTTCTTTTCACGTAGCAGCCGCCCTCGACGATGAAATGGAA
TCGGCCAAGGCCATGTTCGACGTCAACGTCTTCGGCGTGATGCGCATGTGCAAGGTCTTTGTCGACTTGCTCATC
CCAGCCCGCGGCCTCATCGTCAACGTGTCATCCGTCCTCGCCATCATGCCCCTCATCTTAACCAGCGTGTACTCT
TCTAGCAAGGCGGCCCTCGACCAATACACGGCAGTGCTGCGTCGGGAACTGGAGCCCTTTCACGTCCGCATCATG
CTGATCCAGGCCGGCGGTGTCAAAACCTGCATCTCGCGAGATGGTGGTTATACTCTTCCGACCAACTCGCGCTAC
GCTGTCGCTCGTGACGTCTACGACTTGTTTGCCAACAACCTGCAGAAAGTCATGAGCATGCCCGCGGATCGCTTT
GCTGCTCGCGTCGTCGGCGCTGCCCTGGGCGAGCCGCGGCTAGGCGGTCTGCTCGGAGGCACGCCTGATCGTCTC
TGGAAGGGTAACTTGTCCTTTGTTACTTGGGTCTACCAACTTAGTTTTGTCCCTACCTGGGTTCGACGTCTTATT
CTCAACGCCATCGACAAAAACTACCGAATGACGTGGCTGATTCAAGAGGCCCATTCGCGGGACAAGCTGCATCAA
CCATAG
Gene >Ophcf2|01349
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTAAGTGGCAGATGGCACGAAACACCGCTGAAGAAGAGGCTCA
GGGAAAACCTACAGGTGTTCACCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTCCATAGGCGCGGTGGGTGG
CCCCCCCCCCCCAGAAAAGTCGAGATATCTCTCTAAGCAGAGGCATCCATCTATCAGGATGTCACGTCATTGCCA
CCGCCCGCCGGCCCGAGGTGCTCGTCGGACTGGACTCGATGGGTATCAGCACCCTCCAGCTGGATGTTACAGACG
ACGAGAGCGTGGCTCGATGCCGAGACGAGGCCAGGGCCCTACTGGTGGACGGCAAGCTCGACGTGTTGGTCAACA
ATGCGTGCGTTCATTCCCTCAATCAGATGGGAGAAACGAAAAGTATGGCACGAGGACTCACGGAGAGGTAATTGC
AGGGGTTCTTTTCACGTAGCAGCCGCCCTCGACGATGAAATGGAATCGGCCAAGGCCATGTTCGACGTCAACGTC
TTCGGCGTGATGCGCATGTGCAAGGTCTTTGTCGACTTGCTCATCCCAGCCCGCGGCCTCATCGTCAACGTGTCA
TCCGTCCTCGCCATCATGCCCCTCATCTTAACCAGCGTGTACTCTTCTAGCAAGGCGGCCCTCGACCAATACACG
GCAGTGCTGCGTCGGGAACTGGAGCCCTTTCACGTCCGCATCATGCTGATCCAGGCCGGCGGTGTCAAAACCTGC
ATCTCGCGAGATGGTGGTTATACTCTTCCGACCAACTCGCGCTACGCTGTCGCTCGTGACGTCTACGACTTGTTT
GCCAACAACCTGCAGAAAGTCATGAGCATGCCCGCGGATCGCTTTGCTGCTCGCGTCGTCGGCGCTGCCCTGGGC
GAGCCGCGGCTAGGCGGTCTGCTCGGAGGCACGCCTGATCGTCTCTGGAAGGGTAACTTGTCCTTTGTTACTTGG
GTCTACCAACTTAGTTTTGTCCCTACCTGGGTTCGACGTCTTATTCTCAACGCCATCGACAAAAACTACCGAATG
ACGTGGCTGATTCAAGAGGCCCATTCGCGGGACAAGCTGCATCAACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail