Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01349
Gene name
Locationscaffold_01:4760364..4761465
Strand+
Gene length (bp)1101
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.1E-40 6 187
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 1.6E-29 15 188
PF08659 KR KR domain 2.2E-06 6 165

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 124 146 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01349
MARKTTVLITGCSPGGIGHALALEFHRRGCHVIATARRPEVLVGLDSMGISTLQLDVTDDESVARCRDEARALLV
DGKLDVLVNNAGSFHVAAALDDEMESAKAMFDVNVFGVMRMCKVFVDLLIPARGLIVNVSSVLAIMPLILTSVYS
SSKAALDQYTAVLRRELEPFHVRIMLIQAGGVKTCISRDGGYTLPTNSRYAVARDVYDLFANNLQKVMSMPADRF
AARVVGAALGEPRLGGLLGGTPDRLWKGNLSFVTWVYQLSFVPTWVRRLILNAIDKNYRMTWLIQEAHSRDKLHQ
P*
Coding >Ophcf2|01349
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTGTTCACCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTC
CATAGGCGCGGATGTCACGTCATTGCCACCGCCCGCCGGCCCGAGGTGCTCGTCGGACTGGACTCGATGGGTATC
AGCACCCTCCAGCTGGATGTTACAGACGACGAGAGCGTGGCTCGATGCCGAGACGAGGCCAGGGCCCTACTGGTG
GACGGCAAGCTCGACGTGTTGGTCAACAATGCGGGTTCTTTTCACGTAGCAGCCGCCCTCGACGATGAAATGGAA
TCGGCCAAGGCCATGTTCGACGTCAACGTCTTCGGCGTGATGCGCATGTGCAAGGTCTTTGTCGACTTGCTCATC
CCAGCCCGCGGCCTCATCGTCAACGTGTCATCCGTCCTCGCCATCATGCCCCTCATCTTAACCAGCGTGTACTCT
TCTAGCAAGGCGGCCCTCGACCAATACACGGCAGTGCTGCGTCGGGAACTGGAGCCCTTTCACGTCCGCATCATG
CTGATCCAGGCCGGCGGTGTCAAAACCTGCATCTCGCGAGATGGTGGTTATACTCTTCCGACCAACTCGCGCTAC
GCTGTCGCTCGTGACGTCTACGACTTGTTTGCCAACAACCTGCAGAAAGTCATGAGCATGCCCGCGGATCGCTTT
GCTGCTCGCGTCGTCGGCGCTGCCCTGGGCGAGCCGCGGCTAGGCGGTCTGCTCGGAGGCACGCCTGATCGTCTC
TGGAAGGGTAACTTGTCCTTTGTTACTTGGGTCTACCAACTTAGTTTTGTCCCTACCTGGGTTCGACGTCTTATT
CTCAACGCCATCGACAAAAACTACCGAATGACGTGGCTGATTCAAGAGGCCCATTCGCGGGACAAGCTGCATCAA
CCATAG
Transcript >Ophcf2|01349
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTGTTCACCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTC
CATAGGCGCGGATGTCACGTCATTGCCACCGCCCGCCGGCCCGAGGTGCTCGTCGGACTGGACTCGATGGGTATC
AGCACCCTCCAGCTGGATGTTACAGACGACGAGAGCGTGGCTCGATGCCGAGACGAGGCCAGGGCCCTACTGGTG
GACGGCAAGCTCGACGTGTTGGTCAACAATGCGGGTTCTTTTCACGTAGCAGCCGCCCTCGACGATGAAATGGAA
TCGGCCAAGGCCATGTTCGACGTCAACGTCTTCGGCGTGATGCGCATGTGCAAGGTCTTTGTCGACTTGCTCATC
CCAGCCCGCGGCCTCATCGTCAACGTGTCATCCGTCCTCGCCATCATGCCCCTCATCTTAACCAGCGTGTACTCT
TCTAGCAAGGCGGCCCTCGACCAATACACGGCAGTGCTGCGTCGGGAACTGGAGCCCTTTCACGTCCGCATCATG
CTGATCCAGGCCGGCGGTGTCAAAACCTGCATCTCGCGAGATGGTGGTTATACTCTTCCGACCAACTCGCGCTAC
GCTGTCGCTCGTGACGTCTACGACTTGTTTGCCAACAACCTGCAGAAAGTCATGAGCATGCCCGCGGATCGCTTT
GCTGCTCGCGTCGTCGGCGCTGCCCTGGGCGAGCCGCGGCTAGGCGGTCTGCTCGGAGGCACGCCTGATCGTCTC
TGGAAGGGTAACTTGTCCTTTGTTACTTGGGTCTACCAACTTAGTTTTGTCCCTACCTGGGTTCGACGTCTTATT
CTCAACGCCATCGACAAAAACTACCGAATGACGTGGCTGATTCAAGAGGCCCATTCGCGGGACAAGCTGCATCAA
CCATAG
Gene >Ophcf2|01349
ATGGCGCGCAAGACGACGGTCCTCATCACGGGGTAAGTGGCAGATGGCACGAAACACCGCTGAAGAAGAGGCTCA
GGGAAAACCTACAGGTGTTCACCCGGCGGTATCGGCCACGCGCTGGCCCTCGAGTTCCATAGGCGCGGTGGGTGG
CCCCCCCCCCCCAGAAAAGTCGAGATATCTCTCTAAGCAGAGGCATCCATCTATCAGGATGTCACGTCATTGCCA
CCGCCCGCCGGCCCGAGGTGCTCGTCGGACTGGACTCGATGGGTATCAGCACCCTCCAGCTGGATGTTACAGACG
ACGAGAGCGTGGCTCGATGCCGAGACGAGGCCAGGGCCCTACTGGTGGACGGCAAGCTCGACGTGTTGGTCAACA
ATGCGTGCGTTCATTCCCTCAATCAGATGGGAGAAACGAAAAGTATGGCACGAGGACTCACGGAGAGGTAATTGC
AGGGGTTCTTTTCACGTAGCAGCCGCCCTCGACGATGAAATGGAATCGGCCAAGGCCATGTTCGACGTCAACGTC
TTCGGCGTGATGCGCATGTGCAAGGTCTTTGTCGACTTGCTCATCCCAGCCCGCGGCCTCATCGTCAACGTGTCA
TCCGTCCTCGCCATCATGCCCCTCATCTTAACCAGCGTGTACTCTTCTAGCAAGGCGGCCCTCGACCAATACACG
GCAGTGCTGCGTCGGGAACTGGAGCCCTTTCACGTCCGCATCATGCTGATCCAGGCCGGCGGTGTCAAAACCTGC
ATCTCGCGAGATGGTGGTTATACTCTTCCGACCAACTCGCGCTACGCTGTCGCTCGTGACGTCTACGACTTGTTT
GCCAACAACCTGCAGAAAGTCATGAGCATGCCCGCGGATCGCTTTGCTGCTCGCGTCGTCGGCGCTGCCCTGGGC
GAGCCGCGGCTAGGCGGTCTGCTCGGAGGCACGCCTGATCGTCTCTGGAAGGGTAACTTGTCCTTTGTTACTTGG
GTCTACCAACTTAGTTTTGTCCCTACCTGGGTTCGACGTCTTATTCTCAACGCCATCGACAAAAACTACCGAATG
ACGTGGCTGATTCAAGAGGCCCATTCGCGGGACAAGCTGCATCAACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail