Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01341
Gene name
Locationscaffold_01:4738730..4740359
Strand-
Gene length (bp)1629
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04142 Nuc_sug_transp Nucleotide-sugar transporter 2.7E-98 26 387

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0090481 pyrimidine nucleotide-sugar transmembrane transport Yes
GO:0015165 pyrimidine nucleotide-sugar transmembrane transporter activity Yes
GO:0000139 Golgi membrane Yes
GO:0005338 nucleotide-sugar transmembrane transporter activity No
GO:0016020 membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0098588 bounding membrane of organelle No
GO:0006810 transport No
GO:1901264 carbohydrate derivative transport No
GO:0015780 nucleotide-sugar transmembrane transport No
GO:0071702 organic substance transport No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0005215 transporter activity No
GO:0031090 organelle membrane No
GO:0005575 cellular_component No
GO:0015931 nucleobase-containing compound transport No
GO:0003674 molecular_function No
GO:0071705 nitrogen compound transport No
GO:0055085 transmembrane transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 133 155 22
3 164 181 17
4 243 265 22
5 278 300 22
6 315 337 22
7 342 364 22
8 369 388 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01341
MTILEAAGPRRSKVVTLREDKVGRNLSFLTLTFQNSALILIMHYSRMMPPSGDHRYFTSTAVLLNEVIKLAVSLT
LAIYETSQTLAPSTPATILFEQIYNAVFSGDGWKLALPAAFYTLQNLLQYLAVGNLDPVHFQVLYQVKILTTAVF
SVFLLRRHLGLKRWISLFVLTLGVSIVSLPSSESSVDASLFHGIPDHYFPRSNHLLGQAAVADFPPTDSHLTKRS
ATYQGIANDLPPPDPPMNYSAGATAAVVAAVVSGLAGVYFEKILKESPTQASVWIRNIQLSFYSIIAATIGGVFW
QDGIGIRQHGFFEGYNWVVWAAILLQAAGGLIASLVIRDADNIVKNFATSISIVISFIVSVWVFKFTVTASFLFG
TSLVLLATYLYSLPERSRHRPPAVRIVSFEKPAIERVVTPGTTPRLADAARLNSDPFDSKGLATTSSRPNSPMLP
RQSSRTHIMRDD*
Coding >Ophcf2|01341
ATGACGATACTCGAGGCTGCCGGGCCGCGGCGGTCAAAGGTCGTCACCTTGAGAGAGGACAAGGTTGGGAGGAAC
CTGTCCTTTCTGACGCTGACGTTCCAAAACTCGGCCCTTATTCTGATTATGCATTATTCGCGCATGATGCCCCCT
TCGGGCGACCATCGCTACTTTACCTCGACCGCTGTCCTCCTCAACGAGGTCATCAAGCTGGCCGTATCCCTCACC
CTTGCCATATACGAGACGTCCCAGACGCTGGCGCCGAGCACGCCAGCCACCATCCTCTTCGAGCAGATATACAAC
GCTGTCTTTTCCGGTGACGGCTGGAAGCTAGCCCTGCCCGCCGCCTTCTACACCCTGCAGAATCTACTGCAATAT
CTGGCTGTCGGCAACCTGGACCCCGTCCATTTCCAGGTCCTGTACCAGGTCAAGATTCTCACGACTGCTGTCTTC
AGCGTCTTCCTGCTAAGACGCCATCTCGGGCTCAAGCGCTGGATTTCGCTCTTTGTTCTGACTCTGGGCGTCTCC
ATCGTCTCCTTACCCTCGTCTGAGTCCTCAGTCGATGCGAGCCTCTTTCACGGCATCCCGGACCATTACTTTCCA
CGATCCAATCATCTGCTCGGTCAAGCCGCCGTCGCCGACTTTCCGCCCACCGACTCTCACCTGACCAAGCGATCT
GCCACTTATCAGGGCATCGCCAACGACCTGCCGCCCCCGGATCCCCCCATGAACTACTCTGCCGGCGCCACTGCT
GCTGTCGTTGCCGCCGTCGTCTCCGGCCTGGCGGGTGTCTACTTTGAGAAGATTCTCAAGGAGAGCCCTACACAG
GCGAGCGTCTGGATTCGAAACATCCAGCTGAGCTTCTACTCCATCATCGCAGCTACCATCGGTGGCGTCTTCTGG
CAGGATGGTATCGGCATCCGCCAACACGGCTTTTTCGAGGGTTACAATTGGGTCGTGTGGGCTGCCATTTTGTTG
CAAGCGGCCGGCGGCCTGATTGCCAGTCTCGTCATTCGAGACGCGGACAATATTGTCAAGAACTTTGCGACAAGC
ATCAGCATCGTCATCAGCTTCATCGTCAGCGTTTGGGTCTTTAAGTTTACCGTTACCGCCTCGTTTCTCTTCGGA
ACGTCGCTCGTTCTCTTGGCCACGTATCTGTACAGCCTCCCTGAACGGAGTCGCCACCGTCCACCAGCCGTGCGC
ATCGTGAGCTTCGAGAAGCCTGCCATCGAAAGGGTCGTGACTCCGGGGACGACGCCACGCCTCGCGGACGCGGCC
CGCCTCAACTCGGATCCCTTCGACAGCAAGGGTCTAGCCACGACGTCGAGCCGCCCCAACAGCCCCATGCTACCG
CGGCAGTCGAGCCGTACGCACATCATGAGGGATGACTGA
Transcript >Ophcf2|01341
ATGACGATACTCGAGGCTGCCGGGCCGCGGCGGTCAAAGGTCGTCACCTTGAGAGAGGACAAGGTTGGGAGGAAC
CTGTCCTTTCTGACGCTGACGTTCCAAAACTCGGCCCTTATTCTGATTATGCATTATTCGCGCATGATGCCCCCT
TCGGGCGACCATCGCTACTTTACCTCGACCGCTGTCCTCCTCAACGAGGTCATCAAGCTGGCCGTATCCCTCACC
CTTGCCATATACGAGACGTCCCAGACGCTGGCGCCGAGCACGCCAGCCACCATCCTCTTCGAGCAGATATACAAC
GCTGTCTTTTCCGGTGACGGCTGGAAGCTAGCCCTGCCCGCCGCCTTCTACACCCTGCAGAATCTACTGCAATAT
CTGGCTGTCGGCAACCTGGACCCCGTCCATTTCCAGGTCCTGTACCAGGTCAAGATTCTCACGACTGCTGTCTTC
AGCGTCTTCCTGCTAAGACGCCATCTCGGGCTCAAGCGCTGGATTTCGCTCTTTGTTCTGACTCTGGGCGTCTCC
ATCGTCTCCTTACCCTCGTCTGAGTCCTCAGTCGATGCGAGCCTCTTTCACGGCATCCCGGACCATTACTTTCCA
CGATCCAATCATCTGCTCGGTCAAGCCGCCGTCGCCGACTTTCCGCCCACCGACTCTCACCTGACCAAGCGATCT
GCCACTTATCAGGGCATCGCCAACGACCTGCCGCCCCCGGATCCCCCCATGAACTACTCTGCCGGCGCCACTGCT
GCTGTCGTTGCCGCCGTCGTCTCCGGCCTGGCGGGTGTCTACTTTGAGAAGATTCTCAAGGAGAGCCCTACACAG
GCGAGCGTCTGGATTCGAAACATCCAGCTGAGCTTCTACTCCATCATCGCAGCTACCATCGGTGGCGTCTTCTGG
CAGGATGGTATCGGCATCCGCCAACACGGCTTTTTCGAGGGTTACAATTGGGTCGTGTGGGCTGCCATTTTGTTG
CAAGCGGCCGGCGGCCTGATTGCCAGTCTCGTCATTCGAGACGCGGACAATATTGTCAAGAACTTTGCGACAAGC
ATCAGCATCGTCATCAGCTTCATCGTCAGCGTTTGGGTCTTTAAGTTTACCGTTACCGCCTCGTTTCTCTTCGGA
ACGTCGCTCGTTCTCTTGGCCACGTATCTGTACAGCCTCCCTGAACGGAGTCGCCACCGTCCACCAGCCGTGCGC
ATCGTGAGCTTCGAGAAGCCTGCCATCGAAAGGGTCGTGACTCCGGGGACGACGCCACGCCTCGCGGACGCGGCC
CGCCTCAACTCGGATCCCTTCGACAGCAAGGGTCTAGCCACGACGTCGAGCCGCCCCAACAGCCCCATGCTACCG
CGGCAGTCGAGCCGTACGCACATCATGAGGGATGACTGA
Gene >Ophcf2|01341
ATGACGATACTCGAGGCTGCCGGGCCGCGGCGGTCAAAGGTCGTCACCTTGAGAGAGGACAAGGTTGGGAGGAAC
CTGTCCTTTCTGACGGTATGGCTACCACGTCGCCTCGTTGTTATGGACGCTGACTTGTTGTCTAGCTGACGTTCC
AAAACTCGGCCCTTATTCTGGTACGTTGAACCGTCTGCGCTTCGTCGAGGCTTCTTGACTGACGGCACTGGCTCT
TTCCAGATTATGCATTATTCGCGCATGATGCCCCCTTCGGGCGACCATCGCTACTTTACCTCGACCGCTGTCCTC
CTCAACGAGGTCATCAAGCTGGCCGTATCCCTCACCCTTGCCATATACGAGACGTCCCAGACGCTGGCGCCGAGC
ACGCCAGCCACCATCCTCTTCGAGCAGATATACAACGCTGTCTTTTCCGGTGACGGCTGGAAGCTAGCCCTGCCC
GCCGCCTTCTACACCCTGCAGAATCTACTGCAATATCTGGCTGTCGGCAACCTGGACCCCGTCCATTTCCAGGTC
CTGTACCAGGTCAAGGTCGGTGCGCCGTTGTGAGATGGCCATCTCGAGATGTGCTGACGCGCGCACCAGATTCTC
ACGACTGCTGTCTTCAGCGTCTTCCTGCTAAGACGCCATCTCGGGCTCAAGCGCTGGATTTCGCTCTTTGTTCTG
ACTCTGGGCGTCTCCATCGTCTCCTTACCCTCGTCTGAGTCCTCAGTCGATGCGAGCCTCTTTCACGGCATCCCG
GACCATTACTTTCCACGATCCAATCATCTGCTCGGTCAAGCCGCCGTCGCCGACTTTCCGCCCACCGACTCTCAC
CTGACCAAGCGATCTGCCACTTATCAGGGCATCGCCAACGACCTGCCGCCCCCGGATCCCCCCATGAACTACTCT
GCCGGCGCCACTGCTGCTGTCGTTGCCGCCGTCGTCTCCGGCCTGGCGGGTGTCTACTTTGAGAAGATTCTCAAG
GAGAGCCCTACACAGGCGAGCGTCTGGATTCGAAACATCCAGCTGAGCTTCTACTCCATCATCGCAGCTACCATC
GGTGGCGTCTTCTGGCAGGATGGTATCGGCATCCGCCAACACGGCTTTTTCGAGGGTTACAATTGGGTCGTGTGG
GCTGCCATTTTGTTGCAAGCGGCCGGCGGCCTGATTGCCAGTCTCGTCATTCGAGACGCGGACAATATTGTCAAG
AACTTTGCGACAAGCATCAGCATCGTCATCAGCTTCATCGTCAGCGTTTGGGTCTTTAAGTTTACCGTTACCGCC
TCGGTAAGCAATGCAATAACCCTCTGCATCCCTGCAGCGTGACACGTTGGTTGCTGACATGTTGTGGTTCGAAAA
CAGTTTCTCTTCGGAACGTCGCTCGTTCTCTTGGCCACGTATCTGTACAGCCTCCCTGAACGGAGTCGCCACCGT
CCACCAGCCGTGCGCATCGTGAGCTTCGAGAAGCCTGCCATCGAAAGGGTCGTGACTCCGGGGACGACGCCACGC
CTCGCGGACGCGGCCCGCCTCAACTCGGATCCCTTCGACAGCAAGGGTCTAGCCACGACGTCGAGCCGCCCCAAC
AGCCCCATGCTACCGCGGCAGTCGAGCCGTACGCACATCATGAGGGATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail