Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01334
Gene name
Locationscaffold_01:4718769..4719642
Strand-
Gene length (bp)873
Transcript length (bp)807
Coding sequence length (bp)807
Protein length (aa) 269

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 2.9E-08 75 113
PF00646 F-box F-box domain 3.1E-08 75 115

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.4921 0.5646 0.0238 0.0573 0.4639 0.0893 0.2858 0.1161 0.0698 0.068

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2522
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|273
Ophiocordyceps australis map64 (Brazil) OphauB2|5367
Ophiocordyceps camponoti-floridani Ophcf2|01334 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6946
Ophiocordyceps kimflemingae Ophio5|1463
Ophiocordyceps subramaniannii Hirsu2|3689

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01334
MSKDPAPALDRGQLIVQKTSSEAVAAADFYEPSFNDDDNVRIMADDSTTFDDDDDDDDDDDGHSYTNDNRTTYLQ
SLPNEILLHILDFLDVNDLLSTSRTSHLFRSLSLSPVLHLYRRRRSRALLTPLLANPGRPSLAELMSRSIFLTHT
SIVSRRLARSLVSIRLSRRLAARPSAEALVERAVLPKECVPGMCPVLVSPAIVARRKAIEKEKVKDGLRRWIASK
WTGEVREREEDARKSEESQGVGRVWRLTRFWERIGGGDRLTAR*
Coding >Ophcf2|01334
ATGAGCAAGGATCCTGCCCCGGCCCTAGATCGTGGCCAGCTCATCGTGCAGAAGACGTCGTCTGAGGCCGTTGCC
GCTGCCGACTTCTACGAGCCGTCTTTTAATGACGATGACAACGTCCGGATAATGGCCGATGACTCGACCACGTTC
GACGACGACGACGACGATGATGATGATGATGATGGCCACAGCTACACCAACGACAACAGAACCACGTACCTTCAG
AGCCTACCCAACGAGATCCTCCTTCACATTCTTGACTTCCTCGACGTAAACGACCTCCTCTCCACGTCGAGGACC
AGCCACCTATTCCGCAGCCTCTCGCTCAGCCCCGTCCTCCACCTCTACCGCCGCCGTCGCTCTCGCGCCCTACTT
ACTCCCCTGCTGGCCAACCCGGGCCGCCCCTCGCTGGCGGAGCTCATGTCCCGGTCCATCTTCCTGACGCACACG
TCCATCGTCTCGCGCCGCCTGGCCCGCTCGCTCGTCTCCATTCGCCTCTCACGCCGTCTCGCCGCCCGACCATCG
GCCGAGGCCCTCGTCGAGCGCGCAGTCCTACCCAAGGAGTGCGTCCCCGGTATGTGCCCTGTCCTCGTCTCGCCC
GCCATCGTCGCGAGGCGCAAGGCCATTGAGAAGGAAAAAGTCAAGGACGGCCTTCGTCGCTGGATAGCCTCCAAG
TGGACTGGCGAGGTCAGGGAGCGCGAGGAGGACGCCAGAAAGTCCGAGGAGAGCCAAGGCGTCGGTCGAGTCTGG
CGTCTCACCCGCTTCTGGGAGCGCATCGGCGGGGGCGACCGCCTGACCGCAAGGTGA
Transcript >Ophcf2|01334
ATGAGCAAGGATCCTGCCCCGGCCCTAGATCGTGGCCAGCTCATCGTGCAGAAGACGTCGTCTGAGGCCGTTGCC
GCTGCCGACTTCTACGAGCCGTCTTTTAATGACGATGACAACGTCCGGATAATGGCCGATGACTCGACCACGTTC
GACGACGACGACGACGATGATGATGATGATGATGGCCACAGCTACACCAACGACAACAGAACCACGTACCTTCAG
AGCCTACCCAACGAGATCCTCCTTCACATTCTTGACTTCCTCGACGTAAACGACCTCCTCTCCACGTCGAGGACC
AGCCACCTATTCCGCAGCCTCTCGCTCAGCCCCGTCCTCCACCTCTACCGCCGCCGTCGCTCTCGCGCCCTACTT
ACTCCCCTGCTGGCCAACCCGGGCCGCCCCTCGCTGGCGGAGCTCATGTCCCGGTCCATCTTCCTGACGCACACG
TCCATCGTCTCGCGCCGCCTGGCCCGCTCGCTCGTCTCCATTCGCCTCTCACGCCGTCTCGCCGCCCGACCATCG
GCCGAGGCCCTCGTCGAGCGCGCAGTCCTACCCAAGGAGTGCGTCCCCGGTATGTGCCCTGTCCTCGTCTCGCCC
GCCATCGTCGCGAGGCGCAAGGCCATTGAGAAGGAAAAAGTCAAGGACGGCCTTCGTCGCTGGATAGCCTCCAAG
TGGACTGGCGAGGTCAGGGAGCGCGAGGAGGACGCCAGAAAGTCCGAGGAGAGCCAAGGCGTCGGTCGAGTCTGG
CGTCTCACCCGCTTCTGGGAGCGCATCGGCGGGGGCGACCGCCTGACCGCAAGGTGA
Gene >Ophcf2|01334
ATGAGCAAGGATCCTGCCCCGGCCCTAGATCGTGGCCAGCTCATCGTGCAGAAGACGTCGTCTGAGGCCGTTGCC
GCTGCCGACTTCTACGAGCCGTCTTTTAATGACGATGACAACGTCCGGATAATGGCCGATGACTCGACCACGTTC
GACGACGACGACGACGATGATGATGATGATGATGGCCACAGCTACACCAACGACAACAGAACCACGTACCTTCAG
AGCCTACCCAACGAGATCCTCCTTCACATTCTTGACTTCCTCGACGTAAACGACCTCCTCTCCACGTCGAGGGTA
AGCAGAAGCCAGCCCACCCCCGCTCGTCCGCAGCAGCTGCTGATCCGAACCCCTGACTCGCAGACCAGCCACCTA
TTCCGCAGCCTCTCGCTCAGCCCCGTCCTCCACCTCTACCGCCGCCGTCGCTCTCGCGCCCTACTTACTCCCCTG
CTGGCCAACCCGGGCCGCCCCTCGCTGGCGGAGCTCATGTCCCGGTCCATCTTCCTGACGCACACGTCCATCGTC
TCGCGCCGCCTGGCCCGCTCGCTCGTCTCCATTCGCCTCTCACGCCGTCTCGCCGCCCGACCATCGGCCGAGGCC
CTCGTCGAGCGCGCAGTCCTACCCAAGGAGTGCGTCCCCGGTATGTGCCCTGTCCTCGTCTCGCCCGCCATCGTC
GCGAGGCGCAAGGCCATTGAGAAGGAAAAAGTCAAGGACGGCCTTCGTCGCTGGATAGCCTCCAAGTGGACTGGC
GAGGTCAGGGAGCGCGAGGAGGACGCCAGAAAGTCCGAGGAGAGCCAAGGCGTCGGTCGAGTCTGGCGTCTCACC
CGCTTCTGGGAGCGCATCGGCGGGGGCGACCGCCTGACCGCAAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail