Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01300
Gene name
Locationscaffold_01:4622081..4623091
Strand-
Gene length (bp)1010
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13622 4HBT_3 Thioesterase-like superfamily 3.8E-44 30 302

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Peroxisome Peroxisomal targeting signal 0.2471 0.3908 0.0535 0.01 0.4402 0.087 0.2002 0.0427 0.1267 0.4759

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup752
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|971
Ophiocordyceps australis map64 (Brazil) OphauB2|7292
Ophiocordyceps camponoti-floridani Ophcf2|01300 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2654
Ophiocordyceps kimflemingae Ophio5|2780
Ophiocordyceps kimflemingae Ophio5|6509
Ophiocordyceps subramaniannii Hirsu2|2211
Ophiocordyceps subramaniannii Hirsu2|7132

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01300
MAPTTPSHSLARATAVSQLDPSTFAAELLPAFCIGSVPNGGYVASIFLRTARVFWSGRRDVVAVHWQFLSRTRTG
RAVIHVDHVKAGRAISVLHLSLRQDGLLPETPWFDRASSSVVVAAYMTCASLDAEVGISLATDWEVPRPPPGVNL
GDLICGRDPRWRRMWTSLMHRQPLLRQIEFFMPRAGHALPATQDFWIRFASGELFTDTALGFVVDLLSPLLIESY
RPADEQSKGGFAYTDSFWYPTLTMSLDVKKRLPPAGAEWLRLRAEAAVIRNGRFDSRLFVFDADGHLIAWSGQVA
MVVNYERNLAKPSKMKI*
Coding >Ophcf2|01300
ATGGCTCCCACGACACCCTCCCATTCGCTGGCCCGAGCCACAGCCGTCTCTCAGCTCGACCCGTCCACCTTTGCA
GCTGAACTGCTCCCCGCCTTCTGCATCGGCTCCGTGCCGAACGGCGGCTACGTTGCTTCCATCTTCCTCCGGACT
GCCCGGGTGTTTTGGTCCGGGAGGCGAGACGTCGTGGCCGTTCATTGGCAGTTTCTGTCGCGGACGAGAACTGGT
CGAGCCGTAATACATGTCGACCATGTCAAGGCTGGTCGCGCCATTTCCGTCCTGCACCTGAGCCTTCGCCAGGAT
GGCTTGCTGCCGGAGACGCCATGGTTTGATCGTGCGTCCTCATCTGTTGTCGTGGCTGCTTACATGACGTGTGCT
TCCCTCGACGCCGAGGTCGGCATCAGCTTGGCTACAGATTGGGAAGTGCCGCGGCCGCCTCCAGGGGTGAACCTT
GGCGACTTGATCTGCGGTCGAGACCCGCGCTGGCGGCGAATGTGGACCTCGCTCATGCATCGTCAGCCTCTACTC
CGCCAGATAGAATTCTTCATGCCTCGCGCGGGACATGCGCTGCCGGCGACGCAGGATTTCTGGATCCGCTTCGCG
TCCGGGGAGCTCTTCACCGACACGGCCTTGGGCTTCGTCGTCGACTTGCTGAGTCCTTTGCTCATCGAGTCCTAT
CGCCCGGCGGACGAGCAGTCCAAGGGGGGCTTCGCTTACACTGATAGCTTCTGGTATCCGACGCTGACCATGAGT
CTCGACGTCAAGAAGCGGCTGCCCCCCGCCGGTGCCGAGTGGCTGCGTCTACGGGCCGAGGCTGCCGTCATCCGC
AACGGCCGTTTCGACTCGCGTCTGTTTGTCTTCGATGCCGACGGTCATCTAATCGCTTGGAGCGGACAGGTTGCC
ATGGTGGTGAACTATGAGAGGAACCTGGCCAAGCCTAGCAAGATGAAAATTTGA
Transcript >Ophcf2|01300
ATGGCTCCCACGACACCCTCCCATTCGCTGGCCCGAGCCACAGCCGTCTCTCAGCTCGACCCGTCCACCTTTGCA
GCTGAACTGCTCCCCGCCTTCTGCATCGGCTCCGTGCCGAACGGCGGCTACGTTGCTTCCATCTTCCTCCGGACT
GCCCGGGTGTTTTGGTCCGGGAGGCGAGACGTCGTGGCCGTTCATTGGCAGTTTCTGTCGCGGACGAGAACTGGT
CGAGCCGTAATACATGTCGACCATGTCAAGGCTGGTCGCGCCATTTCCGTCCTGCACCTGAGCCTTCGCCAGGAT
GGCTTGCTGCCGGAGACGCCATGGTTTGATCGTGCGTCCTCATCTGTTGTCGTGGCTGCTTACATGACGTGTGCT
TCCCTCGACGCCGAGGTCGGCATCAGCTTGGCTACAGATTGGGAAGTGCCGCGGCCGCCTCCAGGGGTGAACCTT
GGCGACTTGATCTGCGGTCGAGACCCGCGCTGGCGGCGAATGTGGACCTCGCTCATGCATCGTCAGCCTCTACTC
CGCCAGATAGAATTCTTCATGCCTCGCGCGGGACATGCGCTGCCGGCGACGCAGGATTTCTGGATCCGCTTCGCG
TCCGGGGAGCTCTTCACCGACACGGCCTTGGGCTTCGTCGTCGACTTGCTGAGTCCTTTGCTCATCGAGTCCTAT
CGCCCGGCGGACGAGCAGTCCAAGGGGGGCTTCGCTTACACTGATAGCTTCTGGTATCCGACGCTGACCATGAGT
CTCGACGTCAAGAAGCGGCTGCCCCCCGCCGGTGCCGAGTGGCTGCGTCTACGGGCCGAGGCTGCCGTCATCCGC
AACGGCCGTTTCGACTCGCGTCTGTTTGTCTTCGATGCCGACGGTCATCTAATCGCTTGGAGCGGACAGGTTGCC
ATGGTGGTGAACTATGAGAGGAACCTGGCCAAGCCTAGCAAGATGAAAATTTGA
Gene >Ophcf2|01300
ATGGCTCCCACGACACCCTCCCATTCGCTGGCCCGAGCCACAGCCGTCTCTCAGCTCGACCCGTCCACCTTTGCA
GCTGAACTGCTCCCCGCCTTCTGCATCGGCTCCGGTGAGTCCCGTCGTCCGCCGAGGCCGGAGCTCAGCGGCTCA
GCACCCGCCTGATAGTGCCGAACGGCGGCTACGTTGCTTCCATCTTCCTCCGGACTGCCCGGGTGTTTTGGTCCG
GGAGGCGAGACGTCGTGGCCGTTCATTGGCAGTTTCTGTCGCGGACGAGAACTGGTCGAGCCGTAATACATGTCG
ACCATGTCAAGGCTGGTCGCGCCATTTCCGTCCTGCACCTGAGCCTTCGCCAGGATGGCTTGCTGCCGGAGACGC
CATGGTTTGATCGTGCGTCCTCATCTGTTGTCGTGGCTGCTTACATGACGTGTGCTTCCCTCGACGCCGAGGTCG
GCATCAGCTTGGCTACAGATTGGGAAGTGCCGCGGCCGCCTCCAGGGGTGAACCTTGGCGACTTGATCTGCGGTC
GAGACCCGCGCTGGCGGCGAATGTGGACCTCGCTCATGCATCGTCAGCCTCTACTCCGCCAGATAGAATTCTTCA
TGCCTCGCGCGGGACATGCGCTGCCGGCGACGCAGGATTTCTGGATCCGCTTCGCGTCCGGGGAGCTCTTCACCG
ACACGGCCTTGGGCTTCGTCGTCGACTTGCTGAGTCCTTTGCTCATCGAGTCCTATCGCCCGGCGGACGAGCAGT
CCAAGGGGGGCTTCGCTTACACTGATAGCTTCTGGTATCCGACGCTGACCATGAGTCTCGACGTCAAGAAGCGGC
TGCCCCCCGCCGGTGCCGAGTGGCTGCGTCTACGGGCCGAGGCTGCCGTCATCCGCAACGGCCGTTTCGACTCGC
GTCTGTTTGTCTTCGATGCCGACGGTCATCTAATCGCTTGGAGCGGACAGGTTGCCATGGTGGTGAACTATGAGA
GGAACCTGGCCAAGCCTAGCAAGATGAAAATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail