Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01295
Gene name
Locationscaffold_01:4609027..4611805
Strand+
Gene length (bp)2778
Transcript length (bp)2778
Coding sequence length (bp)2778
Protein length (aa) 926

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05346 DUF747 Eukaryotic membrane protein family 6.1E-117 388 838

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.1064 0.1375 0.0383 0.2725 0.214 0.0169 0.8569 0.3301 0.4152 0.0415

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 809 831 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3681
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|963
Ophiocordyceps australis map64 (Brazil) OphauB2|7283
Ophiocordyceps camponoti-floridani Ophcf2|01295 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2649
Ophiocordyceps kimflemingae Ophio5|5541
Ophiocordyceps subramaniannii Hirsu2|7118

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01295
MTDVVQPQAPAGGSNESASPPSKRRSKTNSADNIARLTADEVRQLTSAPESLPVAPAPRRRASDHEQSLDAGRRS
LLSPRTVSSPATPRVLAAGDVGPVPERRFSLASRPRPLSLDAGAMNGFAYGLAAQTAPSSPVIQQHHQEQQQHHH
LQEQQQQQQQQQQQQPQPTHPPPPSTAEDDTQTPPRRRQPSPAPAVIPLPPTSLPTHLQLELAAQRPSPLYIHAS
HSASMPYESNAVKLERLKNVVLLPAYLERTLYFGALACLDAWLHTFTILPIRFVLALAVLARWWGGVIVNEASWL
VGFVWYGLGRLWARAGRSINTKTTTTTTTTTTESESTTTTPPMRPGSKQPQQRRRKSARLPSATASDPGPRTGSF
RHRRTKSQPSNLSAFHKADLLQGAVIICSSAALMTLDASRMYHFVRAQSAIKLYVIFNILEVGDRLLSALGQDIL
ECLFSSETLSRNASGRSKVFVPLAMFVLALAYNCLHSVALYYQVITLNVAVNSYSNALLTLLLSNQFVEIKSTVF
KRFERESLFQLTCADIVERFHLWVMLLIIGMRNVVEVGGLSIPGAGAGDSSSSSSSFSSSQSSSSAPSSASASSS
YSSSSSSSSSSSSSSSSSTGSHNGPLHPASILPHSFTVLPSWLASGEVISPFLIVVGSEMLVDSIKHAYVTKFNN
IKPAFYARTLDILCKDYYTNAFTTPSLTRRLGLAVIPLSCLFIRASIQTYHMFLSTQIPMPIPIPRSTQTSLLVD
EESATPSSPAMMAALSRLDALLRDSLGRATYGYPYGSPLNSRPWYSWTSDDFIAALTMVVFFFIAFLLLLALKLL
LGMALLQYSRNRYAAMKRKEHARAAGRAPPPDTYITAGRRAGTRPEVELSDDRLRWIKADPSEGPPDTGKRRGEA
GGKRAVADDDFQGVSRYDMVAKRIW*
Coding >Ophcf2|01295
ATGACAGACGTCGTCCAGCCCCAGGCCCCAGCCGGTGGCAGCAACGAATCAGCCTCGCCCCCATCCAAGCGTCGC
TCCAAGACAAACAGCGCCGACAACATCGCGCGTCTGACGGCCGATGAGGTACGCCAGTTGACGAGCGCGCCCGAA
TCGCTGCCCGTTGCTCCGGCGCCGAGAAGAAGGGCTTCGGATCACGAGCAGTCGCTGGATGCTGGTCGCCGGTCG
CTGCTTTCGCCGCGGACTGTGTCTTCGCCCGCGACGCCGCGTGTTCTTGCTGCTGGGGATGTTGGGCCCGTTCCT
GAGAGGCGCTTTTCGTTGGCGTCGAGGCCGAGGCCGCTCAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGGCTGGCTGCTCAGACGGCGCCTTCGAGTCCTGTGATTCAACAGCATCACCAAGAGCAGCAGCAGCATCATCAT
CTTCAGGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCAGCCCACACATCCACCTCCTCCATCA
ACGGCAGAAGACGACACGCAAACGCCCCCCCGTCGAAGACAGCCGTCACCAGCCCCAGCCGTGATCCCCCTCCCG
CCAACCTCGCTCCCAACACACCTGCAACTCGAACTGGCAGCACAGCGACCGAGCCCGCTGTACATCCACGCCTCG
CACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTGGAGCGGCTCAAGAACGTGGTGCTTCTGCCGGCC
TACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTCGACGCCTGGCTGCATACCTTTACCATTCTGCCG
ATCCGGTTCGTGCTTGCGCTCGCCGTCTTGGCTCGTTGGTGGGGGGGTGTCATTGTCAATGAGGCTTCCTGGCTT
GTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGGGCTGGGAGGAGCATCAACACCAAGACGACGACG
ACGACGACGACGACGACGACAGAGTCCGAGTCAACGACGACAACACCGCCCATGCGCCCCGGCTCTAAACAACCG
CAACAACGACGCCGGAAATCAGCCCGCCTTCCCTCGGCAACGGCCTCCGACCCCGGCCCCCGAACCGGAAGCTTC
CGTCACCGCCGCACCAAGTCCCAGCCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTC
ATAATCTGCAGCTCAGCCGCCCTCATGACCCTCGACGCCAGCCGAATGTACCACTTCGTCCGCGCCCAGTCAGCC
ATAAAGCTCTACGTCATCTTCAACATCCTCGAGGTCGGCGACCGCCTCCTCTCAGCGCTGGGTCAGGACATCCTC
GAATGCCTCTTCAGCTCCGAGACGCTCTCGCGCAATGCCTCGGGTCGATCCAAGGTGTTCGTCCCGCTGGCCATG
TTCGTGCTCGCGCTGGCGTATAATTGCCTGCATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCC
GTCAACTCGTACTCCAACGCGCTCTTGACCCTCCTGCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTC
AAGCGCTTCGAGAGGGAGAGCCTCTTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATG
CTCCTCATCATCGGCATGCGCAACGTCGTCGAGGTCGGCGGCTTATCCATCCCAGGTGCCGGCGCCGGCGACTCC
TCCTCTTCTTCCTCTTCCTTCTCCTCGTCTCAGTCATCCTCCTCGGCCCCTTCCTCGGCCTCGGCCTCGTCCTCT
TACTCGTCCTCGTCCTCCTCATCCTCGTCCTCCTCGTCCTCGTCCTCTTCCTCGACCGGCAGCCACAACGGCCCC
CTTCACCCAGCCTCTATACTCCCTCACAGCTTCACCGTCTTACCCTCGTGGCTCGCCTCCGGAGAGGTCATCTCG
CCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTACGTCACCAAATTCAACAAC
ATCAAGCCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACAAACGCCTTCACCACCCCG
TCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCGTGCCTCTTCATCCGCGCCTCCATCCAGACCTAC
CACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCTCGCTCGACGCAGACATCCCTCCTCGTCGAC
GAAGAATCCGCCACTCCCTCTTCCCCCGCCATGATGGCCGCCCTCAGCCGTCTCGACGCCCTCCTCCGCGACTCC
CTCGGCCGCGCGACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGGTACTCGTGGACGTCGGAC
GACTTCATCGCCGCCCTGACAATGGTCGTCTTCTTCTTCATCGCCTTCCTCCTCCTCCTCGCCCTCAAACTCCTC
CTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAGGAGCACGCCCGCGCCGCC
GGCCGCGCACCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGGACCCGCCCGGAGGTGGAACTCTCG
GACGATCGCCTCCGCTGGATCAAGGCCGATCCCTCGGAGGGTCCGCCCGATACGGGCAAGAGGCGTGGCGAAGCC
GGGGGCAAGAGGGCCGTCGCTGACGATGACTTCCAGGGCGTTTCTCGCTATGACATGGTGGCCAAGCGCATCTGG
TAG
Transcript >Ophcf2|01295
ATGACAGACGTCGTCCAGCCCCAGGCCCCAGCCGGTGGCAGCAACGAATCAGCCTCGCCCCCATCCAAGCGTCGC
TCCAAGACAAACAGCGCCGACAACATCGCGCGTCTGACGGCCGATGAGGTACGCCAGTTGACGAGCGCGCCCGAA
TCGCTGCCCGTTGCTCCGGCGCCGAGAAGAAGGGCTTCGGATCACGAGCAGTCGCTGGATGCTGGTCGCCGGTCG
CTGCTTTCGCCGCGGACTGTGTCTTCGCCCGCGACGCCGCGTGTTCTTGCTGCTGGGGATGTTGGGCCCGTTCCT
GAGAGGCGCTTTTCGTTGGCGTCGAGGCCGAGGCCGCTCAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGGCTGGCTGCTCAGACGGCGCCTTCGAGTCCTGTGATTCAACAGCATCACCAAGAGCAGCAGCAGCATCATCAT
CTTCAGGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCAGCCCACACATCCACCTCCTCCATCA
ACGGCAGAAGACGACACGCAAACGCCCCCCCGTCGAAGACAGCCGTCACCAGCCCCAGCCGTGATCCCCCTCCCG
CCAACCTCGCTCCCAACACACCTGCAACTCGAACTGGCAGCACAGCGACCGAGCCCGCTGTACATCCACGCCTCG
CACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTGGAGCGGCTCAAGAACGTGGTGCTTCTGCCGGCC
TACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTCGACGCCTGGCTGCATACCTTTACCATTCTGCCG
ATCCGGTTCGTGCTTGCGCTCGCCGTCTTGGCTCGTTGGTGGGGGGGTGTCATTGTCAATGAGGCTTCCTGGCTT
GTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGGGCTGGGAGGAGCATCAACACCAAGACGACGACG
ACGACGACGACGACGACGACAGAGTCCGAGTCAACGACGACAACACCGCCCATGCGCCCCGGCTCTAAACAACCG
CAACAACGACGCCGGAAATCAGCCCGCCTTCCCTCGGCAACGGCCTCCGACCCCGGCCCCCGAACCGGAAGCTTC
CGTCACCGCCGCACCAAGTCCCAGCCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTC
ATAATCTGCAGCTCAGCCGCCCTCATGACCCTCGACGCCAGCCGAATGTACCACTTCGTCCGCGCCCAGTCAGCC
ATAAAGCTCTACGTCATCTTCAACATCCTCGAGGTCGGCGACCGCCTCCTCTCAGCGCTGGGTCAGGACATCCTC
GAATGCCTCTTCAGCTCCGAGACGCTCTCGCGCAATGCCTCGGGTCGATCCAAGGTGTTCGTCCCGCTGGCCATG
TTCGTGCTCGCGCTGGCGTATAATTGCCTGCATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCC
GTCAACTCGTACTCCAACGCGCTCTTGACCCTCCTGCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTC
AAGCGCTTCGAGAGGGAGAGCCTCTTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATG
CTCCTCATCATCGGCATGCGCAACGTCGTCGAGGTCGGCGGCTTATCCATCCCAGGTGCCGGCGCCGGCGACTCC
TCCTCTTCTTCCTCTTCCTTCTCCTCGTCTCAGTCATCCTCCTCGGCCCCTTCCTCGGCCTCGGCCTCGTCCTCT
TACTCGTCCTCGTCCTCCTCATCCTCGTCCTCCTCGTCCTCGTCCTCTTCCTCGACCGGCAGCCACAACGGCCCC
CTTCACCCAGCCTCTATACTCCCTCACAGCTTCACCGTCTTACCCTCGTGGCTCGCCTCCGGAGAGGTCATCTCG
CCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTACGTCACCAAATTCAACAAC
ATCAAGCCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACAAACGCCTTCACCACCCCG
TCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCGTGCCTCTTCATCCGCGCCTCCATCCAGACCTAC
CACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCTCGCTCGACGCAGACATCCCTCCTCGTCGAC
GAAGAATCCGCCACTCCCTCTTCCCCCGCCATGATGGCCGCCCTCAGCCGTCTCGACGCCCTCCTCCGCGACTCC
CTCGGCCGCGCGACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGGTACTCGTGGACGTCGGAC
GACTTCATCGCCGCCCTGACAATGGTCGTCTTCTTCTTCATCGCCTTCCTCCTCCTCCTCGCCCTCAAACTCCTC
CTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAGGAGCACGCCCGCGCCGCC
GGCCGCGCACCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGGACCCGCCCGGAGGTGGAACTCTCG
GACGATCGCCTCCGCTGGATCAAGGCCGATCCCTCGGAGGGTCCGCCCGATACGGGCAAGAGGCGTGGCGAAGCC
GGGGGCAAGAGGGCCGTCGCTGACGATGACTTCCAGGGCGTTTCTCGCTATGACATGGTGGCCAAGCGCATCTGG
TAG
Gene >Ophcf2|01295
ATGACAGACGTCGTCCAGCCCCAGGCCCCAGCCGGTGGCAGCAACGAATCAGCCTCGCCCCCATCCAAGCGTCGC
TCCAAGACAAACAGCGCCGACAACATCGCGCGTCTGACGGCCGATGAGGTACGCCAGTTGACGAGCGCGCCCGAA
TCGCTGCCCGTTGCTCCGGCGCCGAGAAGAAGGGCTTCGGATCACGAGCAGTCGCTGGATGCTGGTCGCCGGTCG
CTGCTTTCGCCGCGGACTGTGTCTTCGCCCGCGACGCCGCGTGTTCTTGCTGCTGGGGATGTTGGGCCCGTTCCT
GAGAGGCGCTTTTCGTTGGCGTCGAGGCCGAGGCCGCTCAGTTTGGATGCTGGGGCTATGAATGGCTTTGCGTAT
GGGCTGGCTGCTCAGACGGCGCCTTCGAGTCCTGTGATTCAACAGCATCACCAAGAGCAGCAGCAGCATCATCAT
CTTCAGGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCCCCAGCCCACACATCCACCTCCTCCATCA
ACGGCAGAAGACGACACGCAAACGCCCCCCCGTCGAAGACAGCCGTCACCAGCCCCAGCCGTGATCCCCCTCCCG
CCAACCTCGCTCCCAACACACCTGCAACTCGAACTGGCAGCACAGCGACCGAGCCCGCTGTACATCCACGCCTCG
CACTCGGCCAGCATGCCGTACGAGTCCAACGCGGTCAAGCTGGAGCGGCTCAAGAACGTGGTGCTTCTGCCGGCC
TACCTGGAGCGCACGCTGTACTTTGGCGCCCTCGCCTGTCTCGACGCCTGGCTGCATACCTTTACCATTCTGCCG
ATCCGGTTCGTGCTTGCGCTCGCCGTCTTGGCTCGTTGGTGGGGGGGTGTCATTGTCAATGAGGCTTCCTGGCTT
GTTGGCTTCGTCTGGTACGGACTCGGGAGGCTCTGGGCCCGGGCTGGGAGGAGCATCAACACCAAGACGACGACG
ACGACGACGACGACGACGACAGAGTCCGAGTCAACGACGACAACACCGCCCATGCGCCCCGGCTCTAAACAACCG
CAACAACGACGCCGGAAATCAGCCCGCCTTCCCTCGGCAACGGCCTCCGACCCCGGCCCCCGAACCGGAAGCTTC
CGTCACCGCCGCACCAAGTCCCAGCCCTCGAACCTCTCCGCCTTCCACAAGGCCGACCTCCTCCAAGGCGCCGTC
ATAATCTGCAGCTCAGCCGCCCTCATGACCCTCGACGCCAGCCGAATGTACCACTTCGTCCGCGCCCAGTCAGCC
ATAAAGCTCTACGTCATCTTCAACATCCTCGAGGTCGGCGACCGCCTCCTCTCAGCGCTGGGTCAGGACATCCTC
GAATGCCTCTTCAGCTCCGAGACGCTCTCGCGCAATGCCTCGGGTCGATCCAAGGTGTTCGTCCCGCTGGCCATG
TTCGTGCTCGCGCTGGCGTATAATTGCCTGCATTCCGTCGCCCTCTACTACCAGGTCATCACCCTCAACGTGGCC
GTCAACTCGTACTCCAACGCGCTCTTGACCCTCCTGCTCTCCAACCAGTTCGTCGAGATCAAGAGCACCGTCTTC
AAGCGCTTCGAGAGGGAGAGCCTCTTTCAACTCACCTGCGCAGACATCGTCGAACGCTTCCACCTCTGGGTCATG
CTCCTCATCATCGGCATGCGCAACGTCGTCGAGGTCGGCGGCTTATCCATCCCAGGTGCCGGCGCCGGCGACTCC
TCCTCTTCTTCCTCTTCCTTCTCCTCGTCTCAGTCATCCTCCTCGGCCCCTTCCTCGGCCTCGGCCTCGTCCTCT
TACTCGTCCTCGTCCTCCTCATCCTCGTCCTCCTCGTCCTCGTCCTCTTCCTCGACCGGCAGCCACAACGGCCCC
CTTCACCCAGCCTCTATACTCCCTCACAGCTTCACCGTCTTACCCTCGTGGCTCGCCTCCGGAGAGGTCATCTCG
CCCTTCCTCATCGTCGTCGGCAGCGAGATGCTCGTCGACAGCATCAAACACGCCTACGTCACCAAATTCAACAAC
ATCAAGCCCGCCTTCTACGCCCGCACCCTCGACATCCTCTGCAAGGATTACTACACAAACGCCTTCACCACCCCG
TCCCTCACCCGTCGTCTCGGCCTCGCCGTCATCCCCCTCTCGTGCCTCTTCATCCGCGCCTCCATCCAGACCTAC
CACATGTTCCTCTCCACCCAGATCCCCATGCCCATCCCCATCCCTCGCTCGACGCAGACATCCCTCCTCGTCGAC
GAAGAATCCGCCACTCCCTCTTCCCCCGCCATGATGGCCGCCCTCAGCCGTCTCGACGCCCTCCTCCGCGACTCC
CTCGGCCGCGCGACCTACGGCTACCCCTACGGCTCCCCCCTCAACTCCCGCCCCTGGTACTCGTGGACGTCGGAC
GACTTCATCGCCGCCCTGACAATGGTCGTCTTCTTCTTCATCGCCTTCCTCCTCCTCCTCGCCCTCAAACTCCTC
CTCGGCATGGCCCTCCTCCAATACTCCCGCAACCGCTACGCCGCCATGAAACGCAAGGAGCACGCCCGCGCCGCC
GGCCGCGCACCCCCCCCGGACACGTACATCACCGCCGGTCGCCGCGCCGGGACCCGCCCGGAGGTGGAACTCTCG
GACGATCGCCTCCGCTGGATCAAGGCCGATCCCTCGGAGGGTCCGCCCGATACGGGCAAGAGGCGTGGCGAAGCC
GGGGGCAAGAGGGCCGTCGCTGACGATGACTTCCAGGGCGTTTCTCGCTATGACATGGTGGCCAAGCGCATCTGG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail