Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01282
Gene name
Locationscaffold_01:4584815..4586875
Strand-
Gene length (bp)2060
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12511 DUF3716 Protein of unknown function (DUF3716) 8.7E-15 274 326

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4726 0.7248 0.3637 0.0566 0.1966 0.0115 0.0451 0.0368 0.0154 0.0382

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1096
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|677
Ophiocordyceps australis map64 (Brazil) OphauB2|2074
Ophiocordyceps camponoti-floridani Ophcf2|01282 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2332
Ophiocordyceps kimflemingae Ophio5|1054
Ophiocordyceps subramaniannii Hirsu2|10105

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01282
MTFGNDDRGVDPERRSLNPSYPVPPQPAVQPAVQPQVQPQVQPSNPQQEAQAAPVLQQPIGWSGYQHVQPALPVL
PQQALSYLSSPPSQTGTGYSLGGSSSSLVGNNSGLHLGESNYSANISASTAASSAPSAENDIAPVVDPALWQYNF
GLPLDNDPQAQQPQAQQPQPQQPQPHGQVQHQVQQLQPEQLQPEHHQPQPQGQPQTQSLQQVYLQQNAGIETTGG
ETAQAAYGGHVRIDSAFCRHLARQPAIRTIIQRRPDQALNLARRSNVEALLGYVTGQPAAQSCRNCVKGHGPWTQ
CVVLQGHLQGSCTNCWFNASGMRCTFQGDKKLRQQQNQEAREAREAQRAQQAQQAPTGQAAFPPPAQQQAIQQGQ
QGQQGQQDQQAIQQGQQDQQAIQQDQQAIQQDQQAIQQLQQAIQQDQQPIQQLQQPIQQDQQLQQPIHQSQQQLG
DQQQPAQSQQNQHSASVHGSPQPSHHSGQTTNPNSPAPPRPRLQAALPAAPRPGFDLGQRGLAGAARRALRRGLD
ETPRPSVHRRLMARIEAAAEELGMRIAEFEDYARSPEGVAFERAARRARREAAVAAATRANRR*
Coding >Ophcf2|01282
ATGACTTTCGGAAACGACGATCGAGGTGTCGACCCTGAGCGCAGGTCGCTCAACCCATCCTACCCGGTTCCGCCA
CAACCTGCAGTTCAGCCTGCTGTTCAACCCCAAGTCCAGCCACAAGTTCAACCCTCCAACCCTCAGCAGGAAGCG
CAGGCCGCACCTGTGCTTCAGCAACCCATCGGCTGGTCCGGTTACCAGCATGTCCAACCTGCTCTGCCCGTCCTT
CCGCAGCAGGCTCTCAGCTACCTCAGCTCGCCTCCCTCGCAAACAGGTACTGGATACTCGTTGGGTGGCAGCAGC
AGCAGCCTTGTTGGAAACAACAGCGGCTTGCATCTCGGTGAGAGCAACTACTCTGCCAACATCAGCGCCTCGACG
GCGGCTTCGTCGGCTCCGTCGGCGGAGAACGACATCGCCCCTGTCGTGGACCCAGCCCTCTGGCAGTACAATTTC
GGTCTTCCTCTGGACAATGATCCCCAGGCCCAGCAGCCCCAGGCCCAGCAGCCCCAGCCTCAGCAGCCCCAGCCT
CACGGTCAGGTCCAGCATCAGGTCCAGCAGCTCCAGCCTGAGCAGCTCCAGCCCGAGCATCACCAGCCTCAGCCT
CAAGGGCAGCCCCAGACTCAGTCTCTGCAGCAGGTCTATCTCCAACAGAACGCCGGCATCGAGACCACCGGAGGC
GAAACAGCTCAGGCAGCCTATGGCGGCCATGTACGGATCGACAGCGCCTTCTGTCGCCACCTAGCCAGACAGCCA
GCCATCCGCACGATAATCCAGCGCCGGCCCGACCAGGCTCTCAACCTGGCCCGCCGCAGCAACGTCGAGGCCCTC
CTCGGCTACGTCACCGGCCAGCCAGCGGCCCAGTCCTGCCGCAACTGCGTCAAGGGCCATGGCCCATGGACTCAG
TGCGTCGTTCTTCAGGGCCATCTGCAGGGCAGCTGCACCAACTGTTGGTTCAATGCTAGCGGGATGAGGTGTACG
TTTCAAGGGGACAAGAAACTTCGCCAGCAGCAAAACCAAGAGGCCCGGGAGGCCCGGGAGGCCCAGAGGGCCCAG
CAAGCCCAGCAGGCTCCAACCGGCCAAGCCGCCTTCCCACCGCCTGCTCAGCAGCAGGCCATCCAGCAGGGCCAG
CAGGGCCAGCAGGGCCAGCAGGACCAGCAGGCCATCCAGCAGGGTCAGCAGGACCAGCAGGCCATCCAGCAGGAC
CAGCAGGCCATCCAGCAGGACCAGCAGGCCATCCAGCAGCTTCAGCAGGCCATTCAGCAGGACCAGCAGCCCATC
CAGCAGCTCCAGCAGCCCATCCAGCAGGACCAGCAGCTCCAGCAGCCTATCCATCAGAGCCAGCAGCAGCTCGGG
GACCAGCAGCAGCCTGCTCAGTCCCAGCAGAACCAGCACTCGGCCTCGGTCCACGGCTCCCCTCAGCCCTCGCAC
CACTCGGGCCAGACCACAAACCCCAACTCGCCCGCCCCCCCCCGTCCTCGACTTCAGGCCGCACTCCCAGCCGCT
CCCCGTCCAGGCTTCGATCTAGGCCAGAGGGGCCTCGCTGGTGCTGCCCGTCGCGCTCTCCGTCGCGGCCTCGAC
GAGACGCCCCGTCCTTCGGTCCACCGCCGTCTCATGGCCCGCATCGAGGCCGCTGCTGAGGAGCTCGGTATGCGC
ATCGCAGAGTTCGAAGACTACGCCCGCAGCCCTGAAGGCGTCGCTTTCGAGCGTGCTGCCAGGAGGGCCAGACGT
GAGGCTGCCGTCGCCGCCGCCACACGCGCCAACCGAAGATAG
Transcript >Ophcf2|01282
ATGACTTTCGGAAACGACGATCGAGGTGTCGACCCTGAGCGCAGGTCGCTCAACCCATCCTACCCGGTTCCGCCA
CAACCTGCAGTTCAGCCTGCTGTTCAACCCCAAGTCCAGCCACAAGTTCAACCCTCCAACCCTCAGCAGGAAGCG
CAGGCCGCACCTGTGCTTCAGCAACCCATCGGCTGGTCCGGTTACCAGCATGTCCAACCTGCTCTGCCCGTCCTT
CCGCAGCAGGCTCTCAGCTACCTCAGCTCGCCTCCCTCGCAAACAGGTACTGGATACTCGTTGGGTGGCAGCAGC
AGCAGCCTTGTTGGAAACAACAGCGGCTTGCATCTCGGTGAGAGCAACTACTCTGCCAACATCAGCGCCTCGACG
GCGGCTTCGTCGGCTCCGTCGGCGGAGAACGACATCGCCCCTGTCGTGGACCCAGCCCTCTGGCAGTACAATTTC
GGTCTTCCTCTGGACAATGATCCCCAGGCCCAGCAGCCCCAGGCCCAGCAGCCCCAGCCTCAGCAGCCCCAGCCT
CACGGTCAGGTCCAGCATCAGGTCCAGCAGCTCCAGCCTGAGCAGCTCCAGCCCGAGCATCACCAGCCTCAGCCT
CAAGGGCAGCCCCAGACTCAGTCTCTGCAGCAGGTCTATCTCCAACAGAACGCCGGCATCGAGACCACCGGAGGC
GAAACAGCTCAGGCAGCCTATGGCGGCCATGTACGGATCGACAGCGCCTTCTGTCGCCACCTAGCCAGACAGCCA
GCCATCCGCACGATAATCCAGCGCCGGCCCGACCAGGCTCTCAACCTGGCCCGCCGCAGCAACGTCGAGGCCCTC
CTCGGCTACGTCACCGGCCAGCCAGCGGCCCAGTCCTGCCGCAACTGCGTCAAGGGCCATGGCCCATGGACTCAG
TGCGTCGTTCTTCAGGGCCATCTGCAGGGCAGCTGCACCAACTGTTGGTTCAATGCTAGCGGGATGAGGTGTACG
TTTCAAGGGGACAAGAAACTTCGCCAGCAGCAAAACCAAGAGGCCCGGGAGGCCCGGGAGGCCCAGAGGGCCCAG
CAAGCCCAGCAGGCTCCAACCGGCCAAGCCGCCTTCCCACCGCCTGCTCAGCAGCAGGCCATCCAGCAGGGCCAG
CAGGGCCAGCAGGGCCAGCAGGACCAGCAGGCCATCCAGCAGGGTCAGCAGGACCAGCAGGCCATCCAGCAGGAC
CAGCAGGCCATCCAGCAGGACCAGCAGGCCATCCAGCAGCTTCAGCAGGCCATTCAGCAGGACCAGCAGCCCATC
CAGCAGCTCCAGCAGCCCATCCAGCAGGACCAGCAGCTCCAGCAGCCTATCCATCAGAGCCAGCAGCAGCTCGGG
GACCAGCAGCAGCCTGCTCAGTCCCAGCAGAACCAGCACTCGGCCTCGGTCCACGGCTCCCCTCAGCCCTCGCAC
CACTCGGGCCAGACCACAAACCCCAACTCGCCCGCCCCCCCCCGTCCTCGACTTCAGGCCGCACTCCCAGCCGCT
CCCCGTCCAGGCTTCGATCTAGGCCAGAGGGGCCTCGCTGGTGCTGCCCGTCGCGCTCTCCGTCGCGGCCTCGAC
GAGACGCCCCGTCCTTCGGTCCACCGCCGTCTCATGGCCCGCATCGAGGCCGCTGCTGAGGAGCTCGGTATGCGC
ATCGCAGAGTTCGAAGACTACGCCCGCAGCCCTGAAGGCGTCGCTTTCGAGCGTGCTGCCAGGAGGGCCAGACGT
GAGGCTGCCGTCGCCGCCGCCACACGCGCCAACCGAAGATAG
Gene >Ophcf2|01282
ATGACTTTCGGAAACGACGATCGAGGTGTCGACCCTGAGCGCAGGTCGCTCAACCCATCCTACCCGGTTCCGCCA
CAACCTGCAGTTCAGCCTGCTGTTCAACCCCAAGTCCAGCCACAAGTTCAACCCTCCAACCCTCAGCAGGAAGCG
CAGGCCGCACCTGTGCTTCAGCAACCCATCGGCTGGTCCGGTTACCAGCATGTCCAACCTGCTCTGCCCGTCCTT
CCGCAGCAGGCTCTCAGCTACCTCAGCTCGCCTCCCTCGCAAACAGGTACTGGATACTCGTTGGGTGGCAGCAGC
AGCAGCCTTGTTGGAAACAACAGCGGCTTGCATCTCGGTGAGAGCAACTACTCTGCCAACATCAGCGCCTCGACG
GCGGCTTCGTCGGCTCCGTCGGCGGAGAACGACATCGCCCCTGTCGTGGACCCAGCCCTCTGGCAGTACAATTTC
GGTCTTCCTCTGGACAATGATCCCCAGGCCCAGCAGCCCCAGGCCCAGCAGCCCCAGCCTCAGCAGCCCCAGCCT
CACGGTCAGGTCCAGCATCAGGTCCAGCAGCTCCAGCCTGAGCAGCTCCAGCCCGAGCATCACCAGCCTCAGCCT
CAAGGGCAGCCCCAGACTCAGTCTCTGCAGCAGGTCTATCTCCAACAGAACGCCGGCATCGAGACCACCGGAGGC
GAAACAGCTCAGGCAGCCTATGGCGGCCATGTACGGATCGACAGCGCCTTCTGTCGCCACCTAGCCAGACAGCCA
GCCATCCGCACGATAATCCAGCGCCGGCCCGACCAGGCTCTCAACCTGGCCCGCCGCAGCAACGTCGAGGCCCTC
CTCGGCTACGTCACCGGCCAGCCAGCGGCCCAGTCCTGCCGCAACTGCGTCAAGGGCCATGGCCCATGGACTCAG
TGCGTCGTTCTTCAGGGCCATCTGCAGGGCAGCTGCACCAACTGTTGGTTCAATGCTAGCGGGATGAGGTGTACG
TTTCAAGGTCAGTTGTTGCGATTTTTTTTTTTTTACCCACTTGCTTCCCTGGCAACGCTCTGTTTTCTTCCTTTC
TCTTCCGTTTCCTCTTCCTTCCCCTTCTCTTTTCCCTTGTCTTGTTTTCCTCCTCCCTCAACCCCTTCTTTTTTC
TCTTCTCTTCTCTTCTTCCTCCCTCAACAACCTTCTTCAGCGAGGATGGAGTCAACAACAGGAGTCATGGAACTG
ACTCTGCGCCTCGCAGGGGACAAGAAACTTCGCCAGCAGCAAAACCAAGAGGCCCGGGAGGCCCGGGAGGCCCAG
AGGGCCCAGCAAGCCCAGCAGGCTCCAACCGGCCAAGCCGCCTTCCCACCGCCTGCTCAGCAGCAGGCCATCCAG
CAGGGCCAGCAGGGCCAGCAGGGCCAGCAGGACCAGCAGGCCATCCAGCAGGGTCAGCAGGACCAGCAGGCCATC
CAGCAGGACCAGCAGGCCATCCAGCAGGACCAGCAGGCCATCCAGCAGCTTCAGCAGGCCATTCAGCAGGACCAG
CAGCCCATCCAGCAGCTCCAGCAGCCCATCCAGCAGGACCAGCAGCTCCAGCAGCCTATCCATCAGAGCCAGCAG
CAGCTCGGGGACCAGCAGCAGCCTGCTCAGTCCCAGCAGAACCAGCACTCGGCCTCGGTCCACGGCTCCCCTCAG
CCCTCGCACCACTCGGGCCAGACCACAAACCCCAACTCGCCCGCCCCCCCCCGTCCTCGACTTCAGGCCGCACTC
CCAGCCGCTCCCCGTCCAGGTCCCCCAACAGAAACAACAACCATCGCTCCGCCCACCCCATCGGAAACCAGATCC
CAGGCTTCGATCTAGGCCAGAGGGGCCTCGCTGGTGCTGCCCGTCGCGCTCTCCGTCGCGGCCTCGACGAGACGC
CCCGTCCTTCGGTCCACCGCCGTCTCATGGCCCGCATCGAGGCCGCTGCTGAGGAGCTCGGTATGCGCATCGCAG
AGTTCGAAGACTACGCCCGCAGCCCTGAAGGCGTCGCTTTCGAGCGTGCTGCCAGGAGGGCCAGACGTGAGGCTG
CCGTCGCCGCCGCCACACGCGCCAACCGAAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail