Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01281
Gene name
Locationscaffold_01:4582248..4583507
Strand+
Gene length (bp)1259
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00503 G-alpha G-protein alpha subunit 4.7E-124 14 342
PF00025 Arf ADP-ribosylation factor family 2.9E-10 176 274

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0019001 guanyl nucleotide binding Yes
GO:0031683 G-protein beta/gamma-subunit complex binding Yes
GO:0044877 protein-containing complex binding No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0007165 signal transduction No
GO:0000166 nucleotide binding No
GO:0065007 biological regulation No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Cell membrane 0.5495 0.2023 0.0528 0.6541 0.1274 0.0051 0.1833 0.3918 0.291 0.0086

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 239.3 131.12 347.48
Alive In ants, during behavior modification 1546.5 501.07 2591.93
Dead In ants, recently dead 949.3 386.68 1511.92

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.041630 yes
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup1607
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6454
Ophiocordyceps australis map64 (Brazil) OphauB2|2076
Ophiocordyceps camponoti-floridani Ophcf2|01281 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2337
Ophiocordyceps kimflemingae Ophio5|1055
Ophiocordyceps subramaniannii Hirsu2|1258

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01281
MGCGMSTEEKEGKARNEEIENQLKRDKMMQRNEIKMLLLGAGESGKSTILKQMKLIHEGGYSRDERESFKEIIFS
NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFMQPTQIEGDVLPPEVGGAIEALWKDRGVQECFKRSREYQLND
SARYYFDNISRIATPDYMPNDQDVLRSRVKTTGITETTFIIGDLTYRMFDVGGQRSERKKWIHCFENVTTILFLV
AISEYDQLLFEDETVNRMQEALTLFDSICNSRWFIKTSIILFLNKIDRFKEKLPVSPMKNYFPDYEGGDDYAAAC
DYILNRFVSLNQHETKQIYTHFTCATDTTQIRFVMAAVNDIIIQENLRLCGLI*
Coding >Ophcf2|01281
ATGGGTTGCGGAATGAGCACGGAGGAGAAAGAGGGGAAGGCTCGTAATGAAGAGATCGAGAATCAGTTAAAGCGC
GACAAGATGATGCAACGCAACGAAATCAAGATGCTGCTGCTGGGTGCCGGTGAATCCGGAAAGTCTACCATTCTC
AAGCAGATGAAGCTCATCCACGAGGGCGGTTACTCCCGAGACGAGCGCGAATCGTTCAAGGAAATCATCTTTAGC
AATACGGTTCAGTCGATGCGTGTGATTCTCGAGGCCATGGAGTCGCTCGAGCTGCCGTTGGAGGACCAACGCATG
GAGTATCACGTCCAGACAATCTTCATGCAGCCTACACAGATCGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGC
GCCATCGAGGCTCTGTGGAAGGACCGCGGCGTTCAAGAGTGTTTTAAGCGCTCTCGCGAATATCAGCTTAACGAC
TCGGCGCGATACTACTTTGACAACATTAGTCGCATCGCTACACCCGACTACATGCCCAATGACCAAGACGTTCTT
CGGTCCCGAGTCAAGACGACTGGCATCACGGAAACGACTTTCATCATCGGCGACCTTACGTACCGTATGTTTGAC
GTCGGAGGACAGAGATCGGAGCGAAAGAAGTGGATCCATTGTTTCGAGAATGTCACAACGATCCTCTTTCTCGTT
GCCATCTCCGAATACGATCAGTTGCTGTTTGAAGACGAGACGGTCAACCGAATGCAGGAGGCGCTGACGTTGTTT
GACTCCATCTGCAATTCGCGATGGTTTATTAAGACGTCCATCATTCTCTTCCTCAACAAGATTGATCGCTTCAAG
GAGAAGCTACCGGTCAGCCCGATGAAGAACTACTTCCCGGACTACGAAGGGGGCGACGACTACGCCGCGGCTTGC
GATTACATCCTCAACCGATTCGTCAGCCTAAACCAGCACGAGACGAAGCAGATTTACACGCATTTCACGTGTGCC
ACCGACACTACACAGATACGGTTCGTCATGGCCGCAGTTAATGACATCATCATCCAAGAGAATCTGAGATTGTGC
GGTCTCATCTAA
Transcript >Ophcf2|01281
ATGGGTTGCGGAATGAGCACGGAGGAGAAAGAGGGGAAGGCTCGTAATGAAGAGATCGAGAATCAGTTAAAGCGC
GACAAGATGATGCAACGCAACGAAATCAAGATGCTGCTGCTGGGTGCCGGTGAATCCGGAAAGTCTACCATTCTC
AAGCAGATGAAGCTCATCCACGAGGGCGGTTACTCCCGAGACGAGCGCGAATCGTTCAAGGAAATCATCTTTAGC
AATACGGTTCAGTCGATGCGTGTGATTCTCGAGGCCATGGAGTCGCTCGAGCTGCCGTTGGAGGACCAACGCATG
GAGTATCACGTCCAGACAATCTTCATGCAGCCTACACAGATCGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGC
GCCATCGAGGCTCTGTGGAAGGACCGCGGCGTTCAAGAGTGTTTTAAGCGCTCTCGCGAATATCAGCTTAACGAC
TCGGCGCGATACTACTTTGACAACATTAGTCGCATCGCTACACCCGACTACATGCCCAATGACCAAGACGTTCTT
CGGTCCCGAGTCAAGACGACTGGCATCACGGAAACGACTTTCATCATCGGCGACCTTACGTACCGTATGTTTGAC
GTCGGAGGACAGAGATCGGAGCGAAAGAAGTGGATCCATTGTTTCGAGAATGTCACAACGATCCTCTTTCTCGTT
GCCATCTCCGAATACGATCAGTTGCTGTTTGAAGACGAGACGGTCAACCGAATGCAGGAGGCGCTGACGTTGTTT
GACTCCATCTGCAATTCGCGATGGTTTATTAAGACGTCCATCATTCTCTTCCTCAACAAGATTGATCGCTTCAAG
GAGAAGCTACCGGTCAGCCCGATGAAGAACTACTTCCCGGACTACGAAGGGGGCGACGACTACGCCGCGGCTTGC
GATTACATCCTCAACCGATTCGTCAGCCTAAACCAGCACGAGACGAAGCAGATTTACACGCATTTCACGTGTGCC
ACCGACACTACACAGATACGGTTCGTCATGGCCGCAGTTAATGACATCATCATCCAAGAGAATCTGAGATTGTGC
GGTCTCATCTAA
Gene >Ophcf2|01281
ATGGGTTGCGGAATGAGCACGGAGGAGAAAGAGGGGAAGGCTCGTAATGAAGAGATCGAGAATCAGTTAAAGCGC
GACAAGATGATGCAACGCAACGAAATCAAGATGCTGCTGCTGGGTACGCTTTTCTTGCTCCTCTCTTCTATCGCC
ATGCTGACAGTTTCTATCAAGGTGCCGGTGAATCCGGAAAGTCTACCATTCTCAAGCAGATGAAGCTCATCCACG
AGGGCGGTTACTCCCGAGACGAGCGCGAATCGTTCAAGGAAATCATCTTTAGCAATACGGTTCAGTCGATGCGTG
TGATTCTCGAGGCCATGGAGTCGCTCGAGCTGCCGTTGGAGGACCAACGCATGGAGTATCACGTCCAGACAATCT
TCATGCAGCCTACACAGATCGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGCGCCATCGAGGCTCTGTGGAAGG
ACCGCGGCGTTCAAGAGTGTTTTAAGCGCTCTCGCGAATATCAGCTTAACGACTCGGCGCGATAGTGAGTCGTCC
CTTTTGCCTCTTGTCGTGATTTTACTGACGGGCTGGCAGCTACTTTGACAACATTAGTCGCATCGCTACACCCGA
CTACATGCCCAATGACCAAGACGTTCTTCGGTCCCGAGTCAAGACGACTGGCATCACGGAAACGACTTTCATCAT
CGGCGACCTTACGTACCGTATGTTTGACGTCGGAGGACAGAGATCGGAGCGAAAGAAGTGGATCCATTGTTTCGA
GAATGTCACAACGATCCTCTTTCTCGTTGCCATCTCCGAATACGATCAGTTGCTGTTTGAAGACGAGACGGTCAA
CCGAATGCAGGAGGCGCTGACGTTGTTTGACTCCATCTGCAATTCGCGATGGTTTATTAAGACGTCCATCATTCT
CTTCCTCAACAAGATTGATCGCTTCAAGGAGAAGCTACCGGTCAGCCCGATGAAGAACTACTTCCCGGACTACGA
AGGGGGCGACGACTACGCCGCGGCTTGCGATTACATCCTCAACCGATTCGTCAGCCTAAACCAGCACGAGACGAA
GCAGATTTACACGCATTTCACGTGTGCCACCGACACTACACAGATACGGTTCGTCATGGCCGCAGTTAATGGTTA
GTCTTGCCCTCCTGCCCGTGGAACTCGACGCGCGTTCTCTCGTGCTGGCTACATGCCATGGCAAAGAAGTTGAGA
CTGACGCATTTGCAGACATCATCATCCAAGAGAATCTGAGATTGTGCGGTCTCATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail