Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01281
Gene name
Locationscaffold_01:4582248..4583507
Strand+
Gene length (bp)1259
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00503 G-alpha G-protein alpha subunit 4.7E-124 14 342
PF00025 Arf ADP-ribosylation factor family 2.9E-10 176 274

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0019001 guanyl nucleotide binding Yes
GO:0031683 G-protein beta/gamma-subunit complex binding Yes
GO:0044877 protein-containing complex binding No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0050794 regulation of cellular process No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0007165 signal transduction No
GO:0000166 nucleotide binding No
GO:0065007 biological regulation No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Cell membrane 0.5495 0.2023 0.0528 0.6541 0.1274 0.0051 0.1833 0.3918 0.291 0.0086

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1607
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6454
Ophiocordyceps australis map64 (Brazil) OphauB2|2076
Ophiocordyceps camponoti-floridani Ophcf2|01281 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2337
Ophiocordyceps kimflemingae Ophio5|1055
Ophiocordyceps subramaniannii Hirsu2|1258

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01281
MGCGMSTEEKEGKARNEEIENQLKRDKMMQRNEIKMLLLGAGESGKSTILKQMKLIHEGGYSRDERESFKEIIFS
NTVQSMRVILEAMESLELPLEDQRMEYHVQTIFMQPTQIEGDVLPPEVGGAIEALWKDRGVQECFKRSREYQLND
SARYYFDNISRIATPDYMPNDQDVLRSRVKTTGITETTFIIGDLTYRMFDVGGQRSERKKWIHCFENVTTILFLV
AISEYDQLLFEDETVNRMQEALTLFDSICNSRWFIKTSIILFLNKIDRFKEKLPVSPMKNYFPDYEGGDDYAAAC
DYILNRFVSLNQHETKQIYTHFTCATDTTQIRFVMAAVNDIIIQENLRLCGLI*
Coding >Ophcf2|01281
ATGGGTTGCGGAATGAGCACGGAGGAGAAAGAGGGGAAGGCTCGTAATGAAGAGATCGAGAATCAGTTAAAGCGC
GACAAGATGATGCAACGCAACGAAATCAAGATGCTGCTGCTGGGTGCCGGTGAATCCGGAAAGTCTACCATTCTC
AAGCAGATGAAGCTCATCCACGAGGGCGGTTACTCCCGAGACGAGCGCGAATCGTTCAAGGAAATCATCTTTAGC
AATACGGTTCAGTCGATGCGTGTGATTCTCGAGGCCATGGAGTCGCTCGAGCTGCCGTTGGAGGACCAACGCATG
GAGTATCACGTCCAGACAATCTTCATGCAGCCTACACAGATCGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGC
GCCATCGAGGCTCTGTGGAAGGACCGCGGCGTTCAAGAGTGTTTTAAGCGCTCTCGCGAATATCAGCTTAACGAC
TCGGCGCGATACTACTTTGACAACATTAGTCGCATCGCTACACCCGACTACATGCCCAATGACCAAGACGTTCTT
CGGTCCCGAGTCAAGACGACTGGCATCACGGAAACGACTTTCATCATCGGCGACCTTACGTACCGTATGTTTGAC
GTCGGAGGACAGAGATCGGAGCGAAAGAAGTGGATCCATTGTTTCGAGAATGTCACAACGATCCTCTTTCTCGTT
GCCATCTCCGAATACGATCAGTTGCTGTTTGAAGACGAGACGGTCAACCGAATGCAGGAGGCGCTGACGTTGTTT
GACTCCATCTGCAATTCGCGATGGTTTATTAAGACGTCCATCATTCTCTTCCTCAACAAGATTGATCGCTTCAAG
GAGAAGCTACCGGTCAGCCCGATGAAGAACTACTTCCCGGACTACGAAGGGGGCGACGACTACGCCGCGGCTTGC
GATTACATCCTCAACCGATTCGTCAGCCTAAACCAGCACGAGACGAAGCAGATTTACACGCATTTCACGTGTGCC
ACCGACACTACACAGATACGGTTCGTCATGGCCGCAGTTAATGACATCATCATCCAAGAGAATCTGAGATTGTGC
GGTCTCATCTAA
Transcript >Ophcf2|01281
ATGGGTTGCGGAATGAGCACGGAGGAGAAAGAGGGGAAGGCTCGTAATGAAGAGATCGAGAATCAGTTAAAGCGC
GACAAGATGATGCAACGCAACGAAATCAAGATGCTGCTGCTGGGTGCCGGTGAATCCGGAAAGTCTACCATTCTC
AAGCAGATGAAGCTCATCCACGAGGGCGGTTACTCCCGAGACGAGCGCGAATCGTTCAAGGAAATCATCTTTAGC
AATACGGTTCAGTCGATGCGTGTGATTCTCGAGGCCATGGAGTCGCTCGAGCTGCCGTTGGAGGACCAACGCATG
GAGTATCACGTCCAGACAATCTTCATGCAGCCTACACAGATCGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGC
GCCATCGAGGCTCTGTGGAAGGACCGCGGCGTTCAAGAGTGTTTTAAGCGCTCTCGCGAATATCAGCTTAACGAC
TCGGCGCGATACTACTTTGACAACATTAGTCGCATCGCTACACCCGACTACATGCCCAATGACCAAGACGTTCTT
CGGTCCCGAGTCAAGACGACTGGCATCACGGAAACGACTTTCATCATCGGCGACCTTACGTACCGTATGTTTGAC
GTCGGAGGACAGAGATCGGAGCGAAAGAAGTGGATCCATTGTTTCGAGAATGTCACAACGATCCTCTTTCTCGTT
GCCATCTCCGAATACGATCAGTTGCTGTTTGAAGACGAGACGGTCAACCGAATGCAGGAGGCGCTGACGTTGTTT
GACTCCATCTGCAATTCGCGATGGTTTATTAAGACGTCCATCATTCTCTTCCTCAACAAGATTGATCGCTTCAAG
GAGAAGCTACCGGTCAGCCCGATGAAGAACTACTTCCCGGACTACGAAGGGGGCGACGACTACGCCGCGGCTTGC
GATTACATCCTCAACCGATTCGTCAGCCTAAACCAGCACGAGACGAAGCAGATTTACACGCATTTCACGTGTGCC
ACCGACACTACACAGATACGGTTCGTCATGGCCGCAGTTAATGACATCATCATCCAAGAGAATCTGAGATTGTGC
GGTCTCATCTAA
Gene >Ophcf2|01281
ATGGGTTGCGGAATGAGCACGGAGGAGAAAGAGGGGAAGGCTCGTAATGAAGAGATCGAGAATCAGTTAAAGCGC
GACAAGATGATGCAACGCAACGAAATCAAGATGCTGCTGCTGGGTACGCTTTTCTTGCTCCTCTCTTCTATCGCC
ATGCTGACAGTTTCTATCAAGGTGCCGGTGAATCCGGAAAGTCTACCATTCTCAAGCAGATGAAGCTCATCCACG
AGGGCGGTTACTCCCGAGACGAGCGCGAATCGTTCAAGGAAATCATCTTTAGCAATACGGTTCAGTCGATGCGTG
TGATTCTCGAGGCCATGGAGTCGCTCGAGCTGCCGTTGGAGGACCAACGCATGGAGTATCACGTCCAGACAATCT
TCATGCAGCCTACACAGATCGAAGGCGACGTGCTGCCTCCGGAAGTCGGCGGCGCCATCGAGGCTCTGTGGAAGG
ACCGCGGCGTTCAAGAGTGTTTTAAGCGCTCTCGCGAATATCAGCTTAACGACTCGGCGCGATAGTGAGTCGTCC
CTTTTGCCTCTTGTCGTGATTTTACTGACGGGCTGGCAGCTACTTTGACAACATTAGTCGCATCGCTACACCCGA
CTACATGCCCAATGACCAAGACGTTCTTCGGTCCCGAGTCAAGACGACTGGCATCACGGAAACGACTTTCATCAT
CGGCGACCTTACGTACCGTATGTTTGACGTCGGAGGACAGAGATCGGAGCGAAAGAAGTGGATCCATTGTTTCGA
GAATGTCACAACGATCCTCTTTCTCGTTGCCATCTCCGAATACGATCAGTTGCTGTTTGAAGACGAGACGGTCAA
CCGAATGCAGGAGGCGCTGACGTTGTTTGACTCCATCTGCAATTCGCGATGGTTTATTAAGACGTCCATCATTCT
CTTCCTCAACAAGATTGATCGCTTCAAGGAGAAGCTACCGGTCAGCCCGATGAAGAACTACTTCCCGGACTACGA
AGGGGGCGACGACTACGCCGCGGCTTGCGATTACATCCTCAACCGATTCGTCAGCCTAAACCAGCACGAGACGAA
GCAGATTTACACGCATTTCACGTGTGCCACCGACACTACACAGATACGGTTCGTCATGGCCGCAGTTAATGGTTA
GTCTTGCCCTCCTGCCCGTGGAACTCGACGCGCGTTCTCTCGTGCTGGCTACATGCCATGGCAAAGAAGTTGAGA
CTGACGCATTTGCAGACATCATCATCCAAGAGAATCTGAGATTGTGCGGTCTCATCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail