Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01279
Gene name
Locationscaffold_01:4576342..4577243
Strand-
Gene length (bp)901
Transcript length (bp)840
Coding sequence length (bp)840
Protein length (aa) 280

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 3.6E-24 30 208

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1644 0.1463 0.4093 0.2941 0.7616 0.0794 0.5099 0.1722 0.1116 0.0096

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup157
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5450
Ophiocordyceps australis 1348a (Ghana) OphauG2|7625
Ophiocordyceps australis map64 (Brazil) OphauB2|3014
Ophiocordyceps australis map64 (Brazil) OphauB2|5252
Ophiocordyceps camponoti-floridani Ophcf2|01279 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07325
Ophiocordyceps camponoti-rufipedis Ophun1|2335
Ophiocordyceps camponoti-rufipedis Ophun1|4433
Ophiocordyceps kimflemingae Ophio5|1059
Ophiocordyceps kimflemingae Ophio5|8368
Ophiocordyceps subramaniannii Hirsu2|11089
Ophiocordyceps subramaniannii Hirsu2|2047

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01279
MAARTLNWSYRLIVPATAAAFVAQSSLYDVRGGTRAVIFDRLSGVKDNVINEGTHFLIPWLQRSIIFDVRTKPRN
IATTTGSKDLQMVSLTLRVLHRPVVTALPKIYQNLGVDYDERVLPSIGNEVLKSIVAQFDAAELITQREAVSQRI
RNDLTRRAAEFNIALEDVSITHMTFGREFTKAVEQKQIAQQDAERARFIVERAEQERQANVIRAEGEAESAETIG
KAIAKAGNGLIQIRKIEASREIAQTLSSNPNVAYLPSGSKQGGGSQLLVSVGRA*
Coding >Ophcf2|01279
ATGGCAGCCAGAACGCTCAACTGGTCATACCGCCTGATCGTCCCCGCGACAGCCGCCGCCTTCGTGGCCCAGTCT
TCGCTCTACGATGTCAGAGGCGGCACGCGGGCCGTCATCTTCGATAGGCTCTCCGGCGTCAAGGACAATGTCATC
AACGAGGGAACCCATTTCTTGATCCCTTGGCTGCAGCGGAGCATCATCTTCGACGTCCGTACCAAGCCGCGTAAT
ATCGCCACGACGACGGGAAGCAAGGATCTGCAGATGGTCAGCTTGACGCTGCGAGTGCTGCACCGGCCCGTTGTC
ACGGCTCTGCCCAAGATATATCAGAACCTCGGCGTTGACTATGATGAGCGCGTCCTCCCCTCCATCGGAAACGAG
GTCCTCAAGTCCATCGTCGCCCAGTTCGACGCCGCCGAGCTCATCACCCAGCGTGAAGCCGTCTCCCAACGCATC
AGGAACGACCTCACCCGCCGCGCGGCCGAGTTCAATATCGCGCTTGAAGACGTCTCCATCACCCACATGACCTTT
GGCCGCGAATTCACAAAGGCCGTCGAGCAGAAGCAGATCGCCCAGCAGGACGCTGAGCGTGCCCGCTTCATCGTC
GAGCGCGCCGAGCAGGAGAGGCAGGCAAACGTCATCCGCGCCGAGGGTGAGGCCGAGAGCGCAGAGACGATTGGC
AAGGCCATCGCCAAAGCTGGCAACGGCCTGATACAGATTCGGAAGATCGAGGCCAGCAGGGAGATTGCCCAGACG
CTGTCATCCAATCCCAACGTCGCCTATCTACCCAGCGGGAGCAAACAAGGAGGCGGCAGTCAGCTACTTGTATCA
GTTGGCAGAGCTTAA
Transcript >Ophcf2|01279
ATGGCAGCCAGAACGCTCAACTGGTCATACCGCCTGATCGTCCCCGCGACAGCCGCCGCCTTCGTGGCCCAGTCT
TCGCTCTACGATGTCAGAGGCGGCACGCGGGCCGTCATCTTCGATAGGCTCTCCGGCGTCAAGGACAATGTCATC
AACGAGGGAACCCATTTCTTGATCCCTTGGCTGCAGCGGAGCATCATCTTCGACGTCCGTACCAAGCCGCGTAAT
ATCGCCACGACGACGGGAAGCAAGGATCTGCAGATGGTCAGCTTGACGCTGCGAGTGCTGCACCGGCCCGTTGTC
ACGGCTCTGCCCAAGATATATCAGAACCTCGGCGTTGACTATGATGAGCGCGTCCTCCCCTCCATCGGAAACGAG
GTCCTCAAGTCCATCGTCGCCCAGTTCGACGCCGCCGAGCTCATCACCCAGCGTGAAGCCGTCTCCCAACGCATC
AGGAACGACCTCACCCGCCGCGCGGCCGAGTTCAATATCGCGCTTGAAGACGTCTCCATCACCCACATGACCTTT
GGCCGCGAATTCACAAAGGCCGTCGAGCAGAAGCAGATCGCCCAGCAGGACGCTGAGCGTGCCCGCTTCATCGTC
GAGCGCGCCGAGCAGGAGAGGCAGGCAAACGTCATCCGCGCCGAGGGTGAGGCCGAGAGCGCAGAGACGATTGGC
AAGGCCATCGCCAAAGCTGGCAACGGCCTGATACAGATTCGGAAGATCGAGGCCAGCAGGGAGATTGCCCAGACG
CTGTCATCCAATCCCAACGTCGCCTATCTACCCAGCGGGAGCAAACAAGGAGGCGGCAGTCAGCTACTTGTATCA
GTTGGCAGAGCTTAA
Gene >Ophcf2|01279
ATGGCAGCCAGAACGCTCAACTGGTCATACCGCCTGATCGTCCCCGCGACAGCCGCCGCCTTCGTGGCCCAGTCT
TCGCTCTACGATGTCAGAGGCGGCACGCGGGCCGTCATCTTCGATAGGCTCTCCGGCGTCAAGGACAATGTCATC
AACGAGGGAACCCATTTCTTGATCCCTTGGCTGCAGCGGAGCATCATCTTCGACGTCCGTACCAAGCCGCGTAAT
ATCGCCACGACGACGGGAAGCAAGGATCTGCAGATGGTCAGCTTGACGCTGCGAGTGCTGCACCGGCCCGTTGTC
ACGGCTCTGCCCAAGATATATCAGGTGAGCTTCCTCCTCGGAGTCCGTATACTCCCCCATTGAAGCATCGACTTA
CCCTCTTCAGAACCTCGGCGTTGACTATGATGAGCGCGTCCTCCCCTCCATCGGAAACGAGGTCCTCAAGTCCAT
CGTCGCCCAGTTCGACGCCGCCGAGCTCATCACCCAGCGTGAAGCCGTCTCCCAACGCATCAGGAACGACCTCAC
CCGCCGCGCGGCCGAGTTCAATATCGCGCTTGAAGACGTCTCCATCACCCACATGACCTTTGGCCGCGAATTCAC
AAAGGCCGTCGAGCAGAAGCAGATCGCCCAGCAGGACGCTGAGCGTGCCCGCTTCATCGTCGAGCGCGCCGAGCA
GGAGAGGCAGGCAAACGTCATCCGCGCCGAGGGTGAGGCCGAGAGCGCAGAGACGATTGGCAAGGCCATCGCCAA
AGCTGGCAACGGCCTGATACAGATTCGGAAGATCGAGGCCAGCAGGGAGATTGCCCAGACGCTGTCATCCAATCC
CAACGTCGCCTATCTACCCAGCGGGAGCAAACAAGGAGGCGGCAGTCAGCTACTTGTATCAGTTGGCAGAGCTTA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail