Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01275
Gene name
Locationscaffold_01:4566643..4568979
Strand+
Gene length (bp)2336
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00218 IGPS Indole-3-glycerol phosphate synthase 7.8E-95 251 513
PF00697 PRAI N-(5'phosphoribosyl)anthranilate (PRA) isomerase 2.0E-45 569 756
PF00117 GATase Glutamine amidotransferase class-I 4.8E-46 29 216
PF07722 Peptidase_C26 Peptidase C26 2.1E-04 96 201

GO

GO Term Description Terminal node
GO:0004425 indole-3-glycerol-phosphate synthase activity Yes
GO:0016787 hydrolase activity Yes
GO:0006568 tryptophan metabolic process Yes
GO:0004640 phosphoribosylanthranilate isomerase activity Yes
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0016831 carboxy-lyase activity No
GO:0044281 small molecule metabolic process No
GO:0003824 catalytic activity No
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0042430 indole-containing compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009987 cellular process No
GO:0016860 intramolecular oxidoreductase activity No
GO:0006576 cellular biogenic amine metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044106 cellular amine metabolic process No
GO:0003674 molecular_function No
GO:0009072 aromatic amino acid family metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:0009308 amine metabolic process No
GO:0006586 indolalkylamine metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008150 biological_process No
GO:0016829 lyase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016853 isomerase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7637 0.5629 0.0695 0.0498 0.494 0.136 0.1325 0.2189 0.2517 0.0089

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4493
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3830
Ophiocordyceps australis map64 (Brazil) OphauB2|6761
Ophiocordyceps camponoti-floridani Ophcf2|01275 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|792
Ophiocordyceps kimflemingae Ophio5|1049
Ophiocordyceps subramaniannii Hirsu2|9373

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01275
MPSSLDIIDHSPHQPEPSPPIPTASNLILIDNYDSFTWNIYQYLVLEGATVHVFRNDQISLQELISKNPTQLIIS
PGPGHPTTDSGISRDAIRHFAGKIPVFGVCMGLQCIFDVYGGDVNSAGEWLHGKTSPLTHDSRGVFAGLEQNLPV
TRYHSLAGTHVTLPDCLEITSWVAKADGSPGIIQGVRHKQLTVEGVQFHPESILTSQGRKMIRNFLHMQGGTWGE
NEKLQRAGQHNSHPVAQDKAKGNNILQRIYANRRAAVAAQKEIPSQRMADLQAAYRLNAAPPLVPLVRRLRQSPF
DVALMAEIKRASPSKGVFALDMDAPTQARKYALAGASVISVLTEPEWFKGSIEDLRSVRQVLDGMPNRPAILRKE
FIFDEYQILEARLAGADTVLLIVKMLEPEALKRLYEYSLSLGMEPLVEVQNGQEMTTAVELGSKVIGVNNRNLES
FEVDLDTTGRLRGMVPEGTLLCALSGINSHKDVLMNKRDGVNAVLVGEAIMRAPDAGVFISELCSGSKQTAGTQP
PKEPLYVKICGTRSVEAAQEAIKSKADFIGICLVPGAKRCISHETALDISDAVHSCSGTAPEARGQMPSSSATDF
FTAAGWRLENHRPRLVGIFQNQPLSEVLQMQRTYRLDVVQLHGDEPIEWSRQIPVPVIRCFKPGQVGIGLRGYHT
IPLLDSGSGSGKLLDVSSVRAALETDPDLRVFLAGGLNPDNVAAAVAALGELGERVLGVDVSSGVEDDGKQSLAK
IKAFVKASKEIR*
Coding >Ophcf2|01275
ATGCCGTCATCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCCATCCCTACGGCGTCC
AACTTGATCCTGATTGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC
GTCCATGTCTTCCGAAACGATCAGATCAGCCTGCAGGAGCTCATTAGCAAGAACCCAACGCAGCTCATTATCAGC
CCCGGCCCAGGACATCCCACGACCGACTCGGGCATCAGCCGAGACGCCATCCGCCACTTTGCGGGAAAGATCCCC
GTCTTTGGCGTCTGTATGGGCCTGCAATGCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGG
CTGCACGGGAAAACGTCGCCCCTGACGCATGATAGCAGGGGTGTCTTTGCCGGTTTAGAGCAGAACCTACCGGTG
ACGAGATATCACTCCCTCGCGGGCACTCACGTCACCTTGCCCGACTGCCTGGAGATTACTTCGTGGGTTGCCAAG
GCTGACGGCTCGCCAGGCATCATCCAGGGTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAATTCCATCCG
GAAAGTATCCTCACGTCTCAGGGACGGAAAATGATACGCAACTTTCTGCACATGCAAGGAGGTACTTGGGGGGAA
AACGAGAAGTTGCAAAGAGCCGGGCAGCACAACAGTCACCCCGTTGCGCAGGACAAGGCAAAGGGCAACAACATA
CTGCAGCGTATATACGCCAACCGCAGGGCTGCCGTTGCCGCTCAAAAGGAGATTCCCTCCCAACGGATGGCCGAT
TTACAGGCAGCCTATCGCCTCAACGCGGCGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTGCGGCAGTCGCCCTTT
GACGTGGCTCTCATGGCCGAGATCAAGCGCGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCG
ACTCAGGCGCGCAAGTACGCCTTGGCCGGAGCCAGCGTCATCTCGGTCCTCACAGAGCCTGAATGGTTCAAAGGG
AGCATTGAGGATTTGCGCTCCGTCCGCCAGGTGTTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAG
TTCATCTTTGACGAGTACCAGATCCTAGAGGCGAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATG
CTAGAGCCGGAAGCTCTGAAGCGCCTCTACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTCCAA
AACGGCCAAGAGATGACGACGGCCGTTGAGTTGGGGTCCAAGGTTATCGGGGTCAATAACCGCAACCTCGAGAGC
TTCGAGGTCGATCTCGATACGACGGGCCGGCTGAGGGGCATGGTACCGGAGGGCACGCTGCTCTGCGCTCTCAGC
GGCATCAACAGCCACAAAGACGTGCTGATGAACAAAAGGGATGGCGTCAACGCAGTCCTCGTCGGCGAGGCCATC
ATGCGAGCGCCGGACGCCGGTGTCTTCATCAGCGAGCTCTGCTCAGGCTCGAAACAGACAGCCGGGACGCAGCCG
CCCAAAGAGCCGCTCTACGTCAAGATTTGCGGAACGCGGTCGGTCGAGGCCGCGCAAGAGGCCATCAAGTCCAAG
GCCGACTTTATTGGCATCTGCCTGGTGCCCGGAGCGAAGCGCTGCATCAGCCACGAGACGGCACTCGATATCTCT
GACGCTGTTCATTCGTGCTCGGGAACTGCCCCGGAGGCACGAGGACAAATGCCCAGCTCCAGTGCGACGGATTTC
TTCACGGCCGCTGGCTGGAGATTGGAAAATCACCGGCCCCGTCTCGTGGGCATCTTCCAGAACCAGCCGCTGAGC
GAGGTGCTGCAGATGCAGAGAACCTACCGGCTTGACGTCGTCCAACTCCACGGAGACGAGCCAATCGAGTGGTCG
AGGCAGATTCCCGTGCCGGTGATTCGCTGCTTTAAGCCAGGCCAAGTCGGCATAGGCCTCCGCGGCTACCACACC
ATCCCGCTACTAGACTCCGGGTCTGGCTCAGGCAAGCTCCTAGACGTGTCGAGCGTTCGGGCCGCGCTGGAGACG
GACCCGGATCTGAGGGTATTCCTGGCGGGCGGGTTGAATCCGGATAACGTGGCTGCGGCCGTGGCGGCACTTGGC
GAGCTGGGAGAGCGAGTGCTAGGCGTCGACGTCAGCAGCGGAGTCGAGGATGATGGGAAGCAGAGCTTGGCAAAG
ATAAAGGCTTTTGTCAAGGCGTCCAAGGAGATTCGATAG
Transcript >Ophcf2|01275
ATGCCGTCATCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCCATCCCTACGGCGTCC
AACTTGATCCTGATTGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC
GTCCATGTCTTCCGAAACGATCAGATCAGCCTGCAGGAGCTCATTAGCAAGAACCCAACGCAGCTCATTATCAGC
CCCGGCCCAGGACATCCCACGACCGACTCGGGCATCAGCCGAGACGCCATCCGCCACTTTGCGGGAAAGATCCCC
GTCTTTGGCGTCTGTATGGGCCTGCAATGCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGG
CTGCACGGGAAAACGTCGCCCCTGACGCATGATAGCAGGGGTGTCTTTGCCGGTTTAGAGCAGAACCTACCGGTG
ACGAGATATCACTCCCTCGCGGGCACTCACGTCACCTTGCCCGACTGCCTGGAGATTACTTCGTGGGTTGCCAAG
GCTGACGGCTCGCCAGGCATCATCCAGGGTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAATTCCATCCG
GAAAGTATCCTCACGTCTCAGGGACGGAAAATGATACGCAACTTTCTGCACATGCAAGGAGGTACTTGGGGGGAA
AACGAGAAGTTGCAAAGAGCCGGGCAGCACAACAGTCACCCCGTTGCGCAGGACAAGGCAAAGGGCAACAACATA
CTGCAGCGTATATACGCCAACCGCAGGGCTGCCGTTGCCGCTCAAAAGGAGATTCCCTCCCAACGGATGGCCGAT
TTACAGGCAGCCTATCGCCTCAACGCGGCGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTGCGGCAGTCGCCCTTT
GACGTGGCTCTCATGGCCGAGATCAAGCGCGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCG
ACTCAGGCGCGCAAGTACGCCTTGGCCGGAGCCAGCGTCATCTCGGTCCTCACAGAGCCTGAATGGTTCAAAGGG
AGCATTGAGGATTTGCGCTCCGTCCGCCAGGTGTTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAG
TTCATCTTTGACGAGTACCAGATCCTAGAGGCGAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATG
CTAGAGCCGGAAGCTCTGAAGCGCCTCTACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTCCAA
AACGGCCAAGAGATGACGACGGCCGTTGAGTTGGGGTCCAAGGTTATCGGGGTCAATAACCGCAACCTCGAGAGC
TTCGAGGTCGATCTCGATACGACGGGCCGGCTGAGGGGCATGGTACCGGAGGGCACGCTGCTCTGCGCTCTCAGC
GGCATCAACAGCCACAAAGACGTGCTGATGAACAAAAGGGATGGCGTCAACGCAGTCCTCGTCGGCGAGGCCATC
ATGCGAGCGCCGGACGCCGGTGTCTTCATCAGCGAGCTCTGCTCAGGCTCGAAACAGACAGCCGGGACGCAGCCG
CCCAAAGAGCCGCTCTACGTCAAGATTTGCGGAACGCGGTCGGTCGAGGCCGCGCAAGAGGCCATCAAGTCCAAG
GCCGACTTTATTGGCATCTGCCTGGTGCCCGGAGCGAAGCGCTGCATCAGCCACGAGACGGCACTCGATATCTCT
GACGCTGTTCATTCGTGCTCGGGAACTGCCCCGGAGGCACGAGGACAAATGCCCAGCTCCAGTGCGACGGATTTC
TTCACGGCCGCTGGCTGGAGATTGGAAAATCACCGGCCCCGTCTCGTGGGCATCTTCCAGAACCAGCCGCTGAGC
GAGGTGCTGCAGATGCAGAGAACCTACCGGCTTGACGTCGTCCAACTCCACGGAGACGAGCCAATCGAGTGGTCG
AGGCAGATTCCCGTGCCGGTGATTCGCTGCTTTAAGCCAGGCCAAGTCGGCATAGGCCTCCGCGGCTACCACACC
ATCCCGCTACTAGACTCCGGGTCTGGCTCAGGCAAGCTCCTAGACGTGTCGAGCGTTCGGGCCGCGCTGGAGACG
GACCCGGATCTGAGGGTATTCCTGGCGGGCGGGTTGAATCCGGATAACGTGGCTGCGGCCGTGGCGGCACTTGGC
GAGCTGGGAGAGCGAGTGCTAGGCGTCGACGTCAGCAGCGGAGTCGAGGATGATGGGAAGCAGAGCTTGGCAAAG
ATAAAGGCTTTTGTCAAGGCGTCCAAGGAGATTCGATAG
Gene >Ophcf2|01275
ATGCCGTCATCTCTCGATATCATCGATCACTCTCCCCATCAGCCGGAGCCGTCACCTCCCATCCCTACGGCGTCC
AACTTGATCCTGATTGACAACTACGACTCCTTCACCTGGAACATCTATCAGTACCTCGTCCTCGAGGGAGCTACC
GTCCATGTCTTCCGAAACGATCAGATCAGCCTGCAGGAGCTCATTAGCAAGAACCCAACGCAGCTCATTATCAGC
CCCGGCCCAGGACATCCCACGACCGACTCGGGCATCAGCCGAGACGCCATCCGCCACTTTGCGGGAAAGATCCCC
GTCTTTGGCGTCTGTATGGGCCTGTGAGCTTCTCCTGTCGCTTTTTGGGCTCGCCACTCACGCTCGTCAGGCAAT
GCATCTTTGATGTTTACGGCGGGGACGTCAACTCTGCCGGAGAGTGGCTGCACGGGAAAACGTCGCCCCTGACGC
ATGATAGCAGGGGTGTCTTTGCCGGTTTAGAGCAGAACCTACCGGTGACGAGATATCACTCCCTCGCGGGCACTC
ACGTCACCTTGCCCGACTGCCTGGAGATTACTTCGTGGGTTGCCAAGGCTGACGGCTCGCCAGGCATCATCCAGG
GTGTCCGTCACAAGCAGCTCACTGTCGAGGGGGTTCAATTCCATCCGGAAAGTATCCTCACGTCTCAGGGACGGA
AAATGATACGCAACTTTCTGCACATGCAAGGAGGTACTTGGGGGGAAAACGAGAAGTTGCAAAGAGCCGGGCAGC
ACAACAGTCACCCCGTTGCGCAGGACAAGGCAAAGGGCAACAACATACTGCAGCGTATATACGCCAACCGCAGGG
CTGCCGTTGCCGCTCAAAAGGAGATTCCCTCCCAACGGATGGCCGATTTACAGGCAGCCTATCGCCTCAACGCGG
CGCCTCCTCTTGTTCCGCTGGTGAGGCGTCTGCGGCAGTCGCCCTTTGACGTGGCTCTCATGGCCGAGATCAAGC
GCGCGTCCCCTTCAAAGGGCGTGTTTGCGCTCGACATGGACGCTCCGACTCAGGCGCGCAAGTACGCCTTGGCCG
GAGCCAGCGTCATCTCGGTCCTCACAGAGCCTGAATGGTTCAAAGGGAGCATTGAGGATTTGCGCTCCGTCCGCC
AGGTGTTGGACGGGATGCCCAATAGGCCAGCTATTCTACGCAAGGAGTTCATCTTTGACGAGTACCAGATCCTAG
AGGCGAGACTTGCAGGCGCCGACACCGTCTTGCTCATCGTCAAGATGCTAGAGCCGGAAGCTCTGAAGCGCCTCT
ACGAATACTCGCTGTCGCTGGGGATGGAGCCGCTCGTCGAGGTCCAAAACGGCCAAGAGATGACGACGGCCGTTG
AGTTGGGGTCCAAGGTTATCGGGGTCAATAACCGCAACCTCGAGAGCTTCGAGGTCGATCTCGATACGACGGGCC
GGCTGAGGGGCATGGTACCGGAGGGCACGCTGCTCTGCGCTCTCAGCGGCATCAACAGCCACAAAGACGTGCTGA
TGAACAAAAGGGATGGCGTCAACGCAGTCCTCGTCGGCGAGGCCATCATGCGAGCGCCGGACGCCGGTGTCTTCA
TCAGCGAGCTCTGCTCAGGCTCGAAACAGACAGCCGGGACGCAGCCGCCCAAAGAGCCGCTCTACGTCAAGATTT
GCGGAACGCGGTCGGTCGAGGCCGCGCAAGAGGCCATCAAGTCCAAGGCCGACTTTATTGGCATCTGCCTGGTGC
CCGGAGCGAAGCGCTGCATCAGCCACGAGACGGCACTCGATATCTCTGACGCTGTTCATTCGTGCTCGGGAACTG
CCCCGGAGGCACGAGGACAAATGCCCAGCTCCAGTGCGACGGATTTCTTCACGGCCGCTGGCTGGAGATTGGAAA
ATCACCGGCCCCGTCTCGTGGGCATCTTCCAGAACCAGCCGCTGAGCGAGGTGCTGCAGATGCAGAGAACCTACC
GGCTTGACGTCGTCCAACTCCACGGAGACGAGCCAATCGAGTGGTCGAGGCAGATTCCCGTGCCGGTGATTCGCT
GCTTTAAGCCAGGCCAAGTCGGCATAGGCCTCCGCGGCTACCACACCATCCCGCTACTAGACTCCGGGTCTGGCT
CAGGCAAGCTCCTAGACGTGTCGAGCGTTCGGGCCGCGCTGGAGACGGACCCGGATCTGAGGGTATTCCTGGCGG
GCGGGTTGAATCCGGATAACGTGGCTGCGGCCGTGGCGGCACTTGGCGAGCTGGGAGAGCGAGTGCTAGGCGTCG
ACGTCAGCAGCGGAGTCGAGGATGATGGGAAGCAGAGCTTGGCAAAGATAAAGGCTTTTGTCAAGGCGTCCAAGG
AGATTCGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail