Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01265
Gene name
Locationscaffold_01:4536052..4538449
Strand+
Gene length (bp)2397
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01393 Chromo_shadow Chromo shadow domain 5.8E-17 190 244
PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain 9.5E-12 77 129

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 284 303 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 141.02 80.10 201.93
Alive In ants, during behavior modification 494.86 221.21 768.51
Dead In ants, recently dead 401.34 202.13 600.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.309475 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01265
MPPALSDDAASDDLEPRPAASVSVEDEEEEDDVASDPEPPRKTDLKPKTSATPKDESEEVEEDEGDDDDEDLGED
EFIVEAIKKHMVDADGSLKFLVKWEGYNKKSDMTWEPEDNLMESASDILAQYYNQIGGRDSIFEESQVASRSKKR
GRASTGTPSTTKRPRKNGLHPADSTPPASARKWSPPAGSWEDEIESIDACHDEGSGKLAVYLIWNNGKKTKHDTT
VVYKKCPQKMLQFYERHIKVIREENLAAGISSLPPPPPINTTHHTTTTTTTEMVQRNHVVAIIIIVIFVILALVA
FGIAKMVTTARKDLTEHSLSSESSESSQEDIVDDD*
Coding >Ophcf2|01265
ATGCCTCCAGCTCTTAGCGACGACGCGGCGTCGGATGACCTCGAGCCCCGGCCAGCCGCGTCAGTGTCTGTTGAA
GACGAGGAGGAAGAAGACGATGTCGCCAGCGATCCCGAACCCCCGCGAAAGACGGACTTGAAGCCAAAGACCTCG
GCTACGCCTAAGGACGAGAGCGAAGAGGTCGAGGAAGACGAGGGCGACGACGACGATGAAGATCTTGGCGAGGAT
GAATTCATCGTCGAGGCTATCAAGAAGCACATGGTAGACGCAGATGGCTCTCTCAAGTTTCTAGTCAAGTGGGAA
GGCTATAACAAGAAGTCGGACATGACGTGGGAGCCAGAAGATAATCTTATGGAGTCTGCGTCGGACATTCTGGCC
CAGTACTACAACCAGATTGGCGGTCGCGACAGCATCTTCGAAGAGTCGCAAGTGGCATCTCGCAGCAAGAAGCGC
GGGCGCGCATCGACCGGGACGCCCTCGACGACGAAGCGACCGCGGAAGAACGGGCTTCACCCAGCCGACTCGACG
CCGCCAGCGAGCGCCAGGAAGTGGAGCCCGCCGGCTGGGTCTTGGGAAGACGAGATTGAGTCCATCGACGCGTGT
CACGATGAGGGCAGCGGCAAGCTGGCCGTCTACCTGATCTGGAACAATGGGAAGAAGACGAAGCACGACACGACG
GTCGTCTACAAGAAGTGTCCGCAAAAGATGCTCCAGTTCTACGAGCGGCACATCAAGGTCATCCGCGAAGAGAAC
CTTGCAGCGGGCATCTCCTCACTCCCACCCCCCCCCCCAATCAACACAACACATCACACCACCACCACCACCACC
ACCGAAATGGTGCAGCGAAACCACGTGGTAGCCATCATCATCATCGTCATCTTCGTCATCCTCGCCCTCGTGGCC
TTTGGCATCGCCAAGATGGTGACGACGGCGCGCAAAGACTTGACGGAGCATTCACTTTCGAGCGAGAGTAGTGAA
TCTTCGCAGGAGGATATCGTCGATGATGACTGA
Transcript >Ophcf2|01265
ATGCCTCCAGCTCTTAGCGACGACGCGGCGTCGGATGACCTCGAGCCCCGGCCAGCCGCGTCAGTGTCTGTTGAA
GACGAGGAGGAAGAAGACGATGTCGCCAGCGATCCCGAACCCCCGCGAAAGACGGACTTGAAGCCAAAGACCTCG
GCTACGCCTAAGGACGAGAGCGAAGAGGTCGAGGAAGACGAGGGCGACGACGACGATGAAGATCTTGGCGAGGAT
GAATTCATCGTCGAGGCTATCAAGAAGCACATGGTAGACGCAGATGGCTCTCTCAAGTTTCTAGTCAAGTGGGAA
GGCTATAACAAGAAGTCGGACATGACGTGGGAGCCAGAAGATAATCTTATGGAGTCTGCGTCGGACATTCTGGCC
CAGTACTACAACCAGATTGGCGGTCGCGACAGCATCTTCGAAGAGTCGCAAGTGGCATCTCGCAGCAAGAAGCGC
GGGCGCGCATCGACCGGGACGCCCTCGACGACGAAGCGACCGCGGAAGAACGGGCTTCACCCAGCCGACTCGACG
CCGCCAGCGAGCGCCAGGAAGTGGAGCCCGCCGGCTGGGTCTTGGGAAGACGAGATTGAGTCCATCGACGCGTGT
CACGATGAGGGCAGCGGCAAGCTGGCCGTCTACCTGATCTGGAACAATGGGAAGAAGACGAAGCACGACACGACG
GTCGTCTACAAGAAGTGTCCGCAAAAGATGCTCCAGTTCTACGAGCGGCACATCAAGGTCATCCGCGAAGAGAAC
CTTGCAGCGGGCATCTCCTCACTCCCACCCCCCCCCCCAATCAACACAACACATCACACCACCACCACCACCACC
ACCGAAATGGTGCAGCGAAACCACGTGGTAGCCATCATCATCATCGTCATCTTCGTCATCCTCGCCCTCGTGGCC
TTTGGCATCGCCAAGATGGTGACGACGGCGCGCAAAGACTTGACGGAGCATTCACTTTCGAGCGAGAGTAGTGAA
TCTTCGCAGGAGGATATCGTCGATGATGACTGA
Gene >Ophcf2|01265
ATGCCTCCAGGTCTGTTCCGCCGCTACTCACCGCCTTTTGCCCTCCGCCCTTCCCCCGCCCCTCTTTGCGCTCTC
TCGCTTTCTCTTGTTGTATGGAAACATTCAGAGGGTCACCTCCCCTTTGCCGCGCCCATCTCCCCCACAGAGAGA
AAGTAAACCCTTAGCACCTTTCCACGCGCCTCGCTTCACTCTTTACTATGCCGCGTAAAAGACGTGTCGCTAAAC
GCGCTGCAGCTCTTAGCGACGACGCGGCGTCGGATGACCTCGAGCCCCGGCCAGCCGCGTCAGTGTCTGTTGAAG
ACGAGGAGGAAGAAGACGATGTCGCCAGCGATCCCGAACCCCCGCGAAAGACGGACTTGAAGCCAAAGACCTCGG
CTACGCCTAAGGACGAGAGCGAAGAGGTCGAGGAAGACGAGGGCGACGACGACGATGAAGATCTTGGCGAGGATG
AGTACGTTGGCGGCGACTTGGGAGATTTTGCGCACGGCTATTGACTCGAAGCAGATTCATCGTCGAGGCTATCAA
GAAGCACATGGTAGACGCAGATGTACGTGTGCAGCCCGCTGTCGCCGACGCAACTGACTGTCCTGTAGGGCTCTC
TCAAGTTTCTAGTCAAGTGGGAAGGCTATAACAAGAAGTCGGACATGACGTGGGAGCCAGAAGATAATCTTATGT
AGGTTTCGGCCGTCGCCGGCGGTCCTGAGCGCGGCATCACTGACATGGTGGTGACGGCAGGGAGTCTGCGTCGGA
CATTCTGGCCCAGTACTACAACCAGATTGGCGGTCGCGACAGCATCTTCGAAGAGTCGCAAGTGGCATCTCGCAG
CAAGAAGCGCGGGCGCGCATCGACCGGGACGCCCTCGACGACGAAGCGACCGCGGAAGAACGGGCTTCACCCAGC
CGACTCGACGCCGCCAGCGAGCGCCAGGAAGTGGAGCCCGCCGGCTGGGTCTTGGGAAGACGAGATTGAGTCCAT
CGACGCGTGTCACGATGAGGGCAGCGGCAAGCTGGCCGTCTACCTGATCTGGAACAATGGGAAGAAGACGAAGCA
CGACACGACGGTCGTCTACAAGAAGTGTCCGCAAAAGGTAAAGGCGACGTCGCGAGGGCTGAGGGATACGAGGCT
GACGTTGAAGCAGATGCTCCAGTTCTACGAGCGGCACATCAAGGTCATCCGCGAAGAGAACCTTGCAGCGGGCAT
GTAGATAGCGGAAGGGGACATTGGGGGAGGATTAAAGGATACCTAGGAGAGGGAGCGATTGGGATTTCTGCTCAG
CAGATGCTTTATATGGGAAGGTCTGTCTCTCTTTTGGGGTTGAGGCTTACTGAGACGGGCTCGGTGTAAGATGGA
GAGGACAGCAAGGCGAATTGGGATGCACCGTTAAAGCAGGCTCTGCTGAGAGAGATTGCGTCTTCTGTGTCTGTG
TTCCATTTCGTCCCTATTGTCTTATTGTTACTCATGGATTGTGTGAATCCTGTTTGGACAAACATCCATGGTAGC
CTCAGGCAGGTACAGGTAGGTAGGTACATTGGGTTACCATTCAATTCGAGTTTATCTTAACTAAGGCTCTTACTG
CGGGGCAGCGATGGTGTTAAGATTTGCTATATGTAGGTGGTAGAGGAAGGTCGCCCAGCCCCCCTCCCCCGAAAT
GGAAGCCCAGCCTTGCGCATTTCACCACCCAAGGGGCCGCTTCTCACGGGCCGCAGCGCCCTTTTTAGCGGGCAT
GCAGCTGCTCCCCAGCACCAGGTGCACCAATGAAAGAGAAGAAGAAGAAGAAGAAGAAGGAGAAGAAAAAAAGGC
GGGTGGCGGGGCAACGGGAGGGCTTGTTGCTTGTTGGAGAGGGGGGATGGTGTATAAAAGCGCTGGCTGGCTGCG
GACGGTAGGCAATGTAGTAGTTGTCTTTTACAGATTGGACGTTGGGTATTAATCTGCTGTCGACGTTGTGTTGCT
TGTTGGTGTTTTACGCGTTGCTGTTGTTGGATCAGCTGCTGTCGTTGCTTCTTGTTGCTGGGTGCTGCTTCCGAC
GATAATCTTGAACTGAACGAGTTTGTTGCGGCTTGCTCCTCGTCGACTCGACTCTTACGGACCTCTTCACATCAT
CATCAGCGCCGCAACTCCGCTCATCAGCATCCACATCCAGCTCCAACCACCAGCTCCTCACTCCCACCCCCCCCC
CCAATCAACACAACACATCACACCACCACCACCACCACCACCGAAATGGTGCAGCGAAACCACGTGGTAGCCATC
ATCATCATCGTCATCTTCGTCATCCTCGCCCTCGTGGCCTTTGGCATCGCCAAGATGGTGACGACGGCGCGCAAA
GACTTGACGGAGCATTCACTTTCGAGCGAGAGTAGTGAATCTTCGCAGGAGGATATCGTCGATGATGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail