Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01260
Gene name
Locationscaffold_01:4523053..4524665
Strand+
Gene length (bp)1612
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 5.3E-22 96 260
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 5.7E-24 298 440

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 70 89 19
2 93 115 22
3 127 149 22
4 164 183 19
5 204 226 22
6 236 258 22
7 294 316 22
8 331 353 22
9 366 388 22
10 398 415 17
11 422 444 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 85.54 49.23 121.86
Alive In ants, during behavior modification 85.76 48.58 122.94
Dead In ants, recently dead 64.67 36.67 92.67

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.992473 no
Alive Dead 0.084038 no
Dead Fungus 0.142099 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01260
MNRKHDVAGERTPLINGGEQSNRASPPVLRNGRSGVCAFFLDSKRTPGTESGNVAVRGLAHTWHVTKVTLLSNYV
NFLLVFVPLGIVAGACQWSPTAVFTINFFAIIPLAAVLSFATEEISIKLGETLGGLLNATFGNAVELIVSIVALR
DGQIEVVQSSMLGSILSNLLLVMGMCFLFGGIVHRGQNGEGTEQRFSSAVAQTTCSLMTLSSASLVIPAALYAVL
TQNGSDEKQTSILILSRGTAIILLLLYVLYLVFQLRTHSNLFDPETPPETATEAIQREAVEEQTPSMSAPAAAAV
LVVVTILVAICADYLVGSIDHIVATAHISKAFLGMILIPIVGNAAEHVTAVVVALRDKMDLAMGVAIGSSIQIAL
GATPFLVIVGWIIGQPMSLHFETFQTVAFAVSVLVVTYTVQDGRSNYLEGAMLLALYIIIAVAFYATPSDAIDKS
YRN*
Coding >Ophcf2|01260
ATGAATCGCAAACACGACGTCGCTGGCGAGCGTACGCCTCTCATCAACGGGGGGGAACAGTCGAATCGGGCGTCG
CCTCCTGTGCTGCGGAACGGTCGGTCTGGTGTCTGTGCCTTTTTCTTGGATTCGAAGCGGACGCCTGGGACGGAG
AGTGGAAATGTGGCGGTTCGCGGTCTGGCACATACGTGGCATGTCACCAAGGTGACGCTTCTTAGCAACTATGTC
AACTTTCTTCTCGTCTTCGTGCCTCTCGGCATAGTCGCCGGCGCTTGTCAATGGAGCCCGACGGCCGTCTTTACA
ATCAACTTCTTCGCCATCATCCCCCTCGCTGCCGTTCTTTCCTTTGCGACCGAGGAGATTTCCATCAAGCTTGGC
GAGACTTTGGGCGGTCTTCTTAACGCTACATTTGGCAATGCCGTTGAGCTGATTGTCAGCATTGTTGCCCTCAGG
GACGGTCAGATCGAGGTGGTGCAATCGTCTATGCTAGGGTCTATCCTGTCCAACTTGCTGCTTGTCATGGGCATG
TGCTTCCTTTTCGGCGGCATCGTTCACCGCGGTCAAAACGGCGAAGGCACCGAGCAGCGCTTCTCCTCCGCCGTC
GCTCAGACTACCTGCTCCCTCATGACGCTCTCGTCCGCCTCCCTCGTCATCCCTGCTGCTCTCTATGCCGTCCTT
ACCCAGAACGGCTCGGATGAGAAGCAAACCAGCATTCTCATCCTATCGAGAGGCACCGCAATTATCCTCTTGCTG
CTTTACGTCCTCTATCTCGTCTTCCAGTTGCGCACCCACAGCAACCTGTTCGACCCCGAAACCCCCCCGGAGACG
GCCACCGAGGCTATCCAACGCGAGGCTGTGGAGGAGCAGACGCCGTCGATGAGTGCGCCCGCTGCAGCCGCCGTC
CTCGTCGTCGTCACCATCCTCGTCGCCATCTGTGCCGATTACCTGGTTGGCAGCATCGATCACATCGTCGCCACC
GCCCACATCAGCAAGGCTTTCCTCGGCATGATTCTCATTCCTATTGTTGGCAACGCAGCCGAGCACGTCACCGCA
GTTGTCGTGGCCCTTCGCGACAAGATGGACCTAGCCATGGGCGTCGCTATCGGCTCATCGATACAGATTGCCCTC
GGCGCCACGCCTTTCCTCGTCATCGTCGGTTGGATCATCGGACAGCCCATGTCGCTGCATTTTGAGACGTTTCAA
ACTGTCGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACTGTTCAGGACGGACGCTCCAACTACCTCGAGGGC
GCCATGCTGCTCGCCCTGTACATCATCATTGCCGTCGCCTTTTACGCGACGCCCAGCGACGCCATCGACAAATCT
TACCGCAACTAA
Transcript >Ophcf2|01260
ATGAATCGCAAACACGACGTCGCTGGCGAGCGTACGCCTCTCATCAACGGGGGGGAACAGTCGAATCGGGCGTCG
CCTCCTGTGCTGCGGAACGGTCGGTCTGGTGTCTGTGCCTTTTTCTTGGATTCGAAGCGGACGCCTGGGACGGAG
AGTGGAAATGTGGCGGTTCGCGGTCTGGCACATACGTGGCATGTCACCAAGGTGACGCTTCTTAGCAACTATGTC
AACTTTCTTCTCGTCTTCGTGCCTCTCGGCATAGTCGCCGGCGCTTGTCAATGGAGCCCGACGGCCGTCTTTACA
ATCAACTTCTTCGCCATCATCCCCCTCGCTGCCGTTCTTTCCTTTGCGACCGAGGAGATTTCCATCAAGCTTGGC
GAGACTTTGGGCGGTCTTCTTAACGCTACATTTGGCAATGCCGTTGAGCTGATTGTCAGCATTGTTGCCCTCAGG
GACGGTCAGATCGAGGTGGTGCAATCGTCTATGCTAGGGTCTATCCTGTCCAACTTGCTGCTTGTCATGGGCATG
TGCTTCCTTTTCGGCGGCATCGTTCACCGCGGTCAAAACGGCGAAGGCACCGAGCAGCGCTTCTCCTCCGCCGTC
GCTCAGACTACCTGCTCCCTCATGACGCTCTCGTCCGCCTCCCTCGTCATCCCTGCTGCTCTCTATGCCGTCCTT
ACCCAGAACGGCTCGGATGAGAAGCAAACCAGCATTCTCATCCTATCGAGAGGCACCGCAATTATCCTCTTGCTG
CTTTACGTCCTCTATCTCGTCTTCCAGTTGCGCACCCACAGCAACCTGTTCGACCCCGAAACCCCCCCGGAGACG
GCCACCGAGGCTATCCAACGCGAGGCTGTGGAGGAGCAGACGCCGTCGATGAGTGCGCCCGCTGCAGCCGCCGTC
CTCGTCGTCGTCACCATCCTCGTCGCCATCTGTGCCGATTACCTGGTTGGCAGCATCGATCACATCGTCGCCACC
GCCCACATCAGCAAGGCTTTCCTCGGCATGATTCTCATTCCTATTGTTGGCAACGCAGCCGAGCACGTCACCGCA
GTTGTCGTGGCCCTTCGCGACAAGATGGACCTAGCCATGGGCGTCGCTATCGGCTCATCGATACAGATTGCCCTC
GGCGCCACGCCTTTCCTCGTCATCGTCGGTTGGATCATCGGACAGCCCATGTCGCTGCATTTTGAGACGTTTCAA
ACTGTCGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACTGTTCAGGACGGACGCTCCAACTACCTCGAGGGC
GCCATGCTGCTCGCCCTGTACATCATCATTGCCGTCGCCTTTTACGCGACGCCCAGCGACGCCATCGACAAATCT
TACCGCAACTAA
Gene >Ophcf2|01260
ATGAATCGCAAACACGACGTCGCTGGCGAGCGTACGCCTCTCATCAACGGGGGGGAACAGTCGAATCGGGCGTCG
CCTCCTGTGCTGCGGAACGGTCGGTCTGGTGTCTGTGCCTTTTTCTTGGATTCGAAGCGGACGCCTGGGACGGAG
AGTGGAAATGTGGCGGTTCGCGGTCTGGCACATACGTGGCATGTCACCAAGGTGACGCTTCTTAGCAGTATGTGT
CGTTGTCGCCGCCTTGGATGGTTGTGGATGACGATGGCTGACGGGACAGGACAACAGACTATGTCAACTTTCTTC
TCGTCTTCGTGCCTCTCGGCATAGTCGCCGGCGCTTGTCAATGGAGCCCGACGGCCGTCTTTACAATCAACTTCT
TCGCCATCATCCCCCTCGCTGCCGTTCTTTCCTTTGCGACCGAGGAGATTTCCATCAAGCTTGGCGAGACTTTGG
GCGGTCTTCTTAACGCTACATTTGGCAATGCCGTTGAGCTGATTGTTCGTCCACCCCTGGTTTGTTCCTATCTTG
GCCTGCGCGCTGACTGTCTTCATCAGGTCAGCATTGTTGCCCTCAGGGACGGTCAGATCGAGGTGGTGCAATCGT
CTATGCTAGGGTCTATCCTGTCCAACTTGCTGCTTGTCATGGGCATGTGCTTCCTTTTCGGCGGCATCGTTCACC
GCGGTCAAAACGGCGAAGGCACCGAGCAGCGCTTCTCCTCCGCCGTCGCTCAGACTACCTGCTCCCTCATGACGC
TCTCGTCCGCCTCCCTCGTCATCCCTGCTGCTGTGAGTTTGAGTCGTCCATCGGATCCTTCTCTTATTCAGGAGC
TGACATGCCGACCTCCTCGCAGCTCTATGCCGTCCTTACCCAGAACGGCTCGGATGAGAAGCAAACCAGCATTCT
CATCCTATCGAGAGGCACCGCAATTATCCTCTTGCTGCTTTACGTCCTCTATCTCGTCTTCCAGTTGCGCACCCA
CAGCAACCTGTTCGACCCCGAAACCCCCCCGGAGACGGCCACCGAGGCTATCCAACGCGAGGCTGTGGAGGAGCA
GACGCCGTCGATGAGTGCGCCCGCTGCAGCCGCCGTCCTCGTCGTCGTCACCATCCTCGTCGCCATCTGTGCCGA
TTACCTGGTTGGCAGCATCGATCACATCGTCGCCACCGCCCACATCAGCAAGGCTTTCCTCGGCATGATTCTCAT
TCCTATTGTTGGCAACGCAGCCGAGCACGTCACCGCAGTTGTCGTGGCCCTTCGCGACAAGATGGACCTAGCCAT
GGGCGTCGCTATCGGCTCATCGATACAGATTGCCCTCGGCGCCACGCCTTTCCTCGTCATCGTCGGTTGGATCAT
CGGACAGCCCATGTCGCTGCATTTTGAGACGTGTACGTTGATGTTTCCGCCCTCACTGAAGAAGCCAAGTCTCGT
CGTACTGACCGCTTAATCAGTTCAAACTGTCGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACTGTTCAGGA
CGGACGCTCCAACTACCTCGAGGGCGCCATGCTGCTCGCCCTGTACATCATCATTGCCGTCGCCTTTTACGCGAC
GCCCAGCGACGCCATCGACAAATCTTACCGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail