Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01260
Gene name
Locationscaffold_01:4523053..4524665
Strand+
Gene length (bp)1612
Transcript length (bp)1362
Coding sequence length (bp)1362
Protein length (aa) 454

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 5.3E-22 96 260
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 5.7E-24 298 440

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 70 89 19
2 93 115 22
3 127 149 22
4 164 183 19
5 204 226 22
6 236 258 22
7 294 316 22
8 331 353 22
9 366 388 22
10 398 415 17
11 422 444 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01260
MNRKHDVAGERTPLINGGEQSNRASPPVLRNGRSGVCAFFLDSKRTPGTESGNVAVRGLAHTWHVTKVTLLSNYV
NFLLVFVPLGIVAGACQWSPTAVFTINFFAIIPLAAVLSFATEEISIKLGETLGGLLNATFGNAVELIVSIVALR
DGQIEVVQSSMLGSILSNLLLVMGMCFLFGGIVHRGQNGEGTEQRFSSAVAQTTCSLMTLSSASLVIPAALYAVL
TQNGSDEKQTSILILSRGTAIILLLLYVLYLVFQLRTHSNLFDPETPPETATEAIQREAVEEQTPSMSAPAAAAV
LVVVTILVAICADYLVGSIDHIVATAHISKAFLGMILIPIVGNAAEHVTAVVVALRDKMDLAMGVAIGSSIQIAL
GATPFLVIVGWIIGQPMSLHFETFQTVAFAVSVLVVTYTVQDGRSNYLEGAMLLALYIIIAVAFYATPSDAIDKS
YRN*
Coding >Ophcf2|01260
ATGAATCGCAAACACGACGTCGCTGGCGAGCGTACGCCTCTCATCAACGGGGGGGAACAGTCGAATCGGGCGTCG
CCTCCTGTGCTGCGGAACGGTCGGTCTGGTGTCTGTGCCTTTTTCTTGGATTCGAAGCGGACGCCTGGGACGGAG
AGTGGAAATGTGGCGGTTCGCGGTCTGGCACATACGTGGCATGTCACCAAGGTGACGCTTCTTAGCAACTATGTC
AACTTTCTTCTCGTCTTCGTGCCTCTCGGCATAGTCGCCGGCGCTTGTCAATGGAGCCCGACGGCCGTCTTTACA
ATCAACTTCTTCGCCATCATCCCCCTCGCTGCCGTTCTTTCCTTTGCGACCGAGGAGATTTCCATCAAGCTTGGC
GAGACTTTGGGCGGTCTTCTTAACGCTACATTTGGCAATGCCGTTGAGCTGATTGTCAGCATTGTTGCCCTCAGG
GACGGTCAGATCGAGGTGGTGCAATCGTCTATGCTAGGGTCTATCCTGTCCAACTTGCTGCTTGTCATGGGCATG
TGCTTCCTTTTCGGCGGCATCGTTCACCGCGGTCAAAACGGCGAAGGCACCGAGCAGCGCTTCTCCTCCGCCGTC
GCTCAGACTACCTGCTCCCTCATGACGCTCTCGTCCGCCTCCCTCGTCATCCCTGCTGCTCTCTATGCCGTCCTT
ACCCAGAACGGCTCGGATGAGAAGCAAACCAGCATTCTCATCCTATCGAGAGGCACCGCAATTATCCTCTTGCTG
CTTTACGTCCTCTATCTCGTCTTCCAGTTGCGCACCCACAGCAACCTGTTCGACCCCGAAACCCCCCCGGAGACG
GCCACCGAGGCTATCCAACGCGAGGCTGTGGAGGAGCAGACGCCGTCGATGAGTGCGCCCGCTGCAGCCGCCGTC
CTCGTCGTCGTCACCATCCTCGTCGCCATCTGTGCCGATTACCTGGTTGGCAGCATCGATCACATCGTCGCCACC
GCCCACATCAGCAAGGCTTTCCTCGGCATGATTCTCATTCCTATTGTTGGCAACGCAGCCGAGCACGTCACCGCA
GTTGTCGTGGCCCTTCGCGACAAGATGGACCTAGCCATGGGCGTCGCTATCGGCTCATCGATACAGATTGCCCTC
GGCGCCACGCCTTTCCTCGTCATCGTCGGTTGGATCATCGGACAGCCCATGTCGCTGCATTTTGAGACGTTTCAA
ACTGTCGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACTGTTCAGGACGGACGCTCCAACTACCTCGAGGGC
GCCATGCTGCTCGCCCTGTACATCATCATTGCCGTCGCCTTTTACGCGACGCCCAGCGACGCCATCGACAAATCT
TACCGCAACTAA
Transcript >Ophcf2|01260
ATGAATCGCAAACACGACGTCGCTGGCGAGCGTACGCCTCTCATCAACGGGGGGGAACAGTCGAATCGGGCGTCG
CCTCCTGTGCTGCGGAACGGTCGGTCTGGTGTCTGTGCCTTTTTCTTGGATTCGAAGCGGACGCCTGGGACGGAG
AGTGGAAATGTGGCGGTTCGCGGTCTGGCACATACGTGGCATGTCACCAAGGTGACGCTTCTTAGCAACTATGTC
AACTTTCTTCTCGTCTTCGTGCCTCTCGGCATAGTCGCCGGCGCTTGTCAATGGAGCCCGACGGCCGTCTTTACA
ATCAACTTCTTCGCCATCATCCCCCTCGCTGCCGTTCTTTCCTTTGCGACCGAGGAGATTTCCATCAAGCTTGGC
GAGACTTTGGGCGGTCTTCTTAACGCTACATTTGGCAATGCCGTTGAGCTGATTGTCAGCATTGTTGCCCTCAGG
GACGGTCAGATCGAGGTGGTGCAATCGTCTATGCTAGGGTCTATCCTGTCCAACTTGCTGCTTGTCATGGGCATG
TGCTTCCTTTTCGGCGGCATCGTTCACCGCGGTCAAAACGGCGAAGGCACCGAGCAGCGCTTCTCCTCCGCCGTC
GCTCAGACTACCTGCTCCCTCATGACGCTCTCGTCCGCCTCCCTCGTCATCCCTGCTGCTCTCTATGCCGTCCTT
ACCCAGAACGGCTCGGATGAGAAGCAAACCAGCATTCTCATCCTATCGAGAGGCACCGCAATTATCCTCTTGCTG
CTTTACGTCCTCTATCTCGTCTTCCAGTTGCGCACCCACAGCAACCTGTTCGACCCCGAAACCCCCCCGGAGACG
GCCACCGAGGCTATCCAACGCGAGGCTGTGGAGGAGCAGACGCCGTCGATGAGTGCGCCCGCTGCAGCCGCCGTC
CTCGTCGTCGTCACCATCCTCGTCGCCATCTGTGCCGATTACCTGGTTGGCAGCATCGATCACATCGTCGCCACC
GCCCACATCAGCAAGGCTTTCCTCGGCATGATTCTCATTCCTATTGTTGGCAACGCAGCCGAGCACGTCACCGCA
GTTGTCGTGGCCCTTCGCGACAAGATGGACCTAGCCATGGGCGTCGCTATCGGCTCATCGATACAGATTGCCCTC
GGCGCCACGCCTTTCCTCGTCATCGTCGGTTGGATCATCGGACAGCCCATGTCGCTGCATTTTGAGACGTTTCAA
ACTGTCGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACTGTTCAGGACGGACGCTCCAACTACCTCGAGGGC
GCCATGCTGCTCGCCCTGTACATCATCATTGCCGTCGCCTTTTACGCGACGCCCAGCGACGCCATCGACAAATCT
TACCGCAACTAA
Gene >Ophcf2|01260
ATGAATCGCAAACACGACGTCGCTGGCGAGCGTACGCCTCTCATCAACGGGGGGGAACAGTCGAATCGGGCGTCG
CCTCCTGTGCTGCGGAACGGTCGGTCTGGTGTCTGTGCCTTTTTCTTGGATTCGAAGCGGACGCCTGGGACGGAG
AGTGGAAATGTGGCGGTTCGCGGTCTGGCACATACGTGGCATGTCACCAAGGTGACGCTTCTTAGCAGTATGTGT
CGTTGTCGCCGCCTTGGATGGTTGTGGATGACGATGGCTGACGGGACAGGACAACAGACTATGTCAACTTTCTTC
TCGTCTTCGTGCCTCTCGGCATAGTCGCCGGCGCTTGTCAATGGAGCCCGACGGCCGTCTTTACAATCAACTTCT
TCGCCATCATCCCCCTCGCTGCCGTTCTTTCCTTTGCGACCGAGGAGATTTCCATCAAGCTTGGCGAGACTTTGG
GCGGTCTTCTTAACGCTACATTTGGCAATGCCGTTGAGCTGATTGTTCGTCCACCCCTGGTTTGTTCCTATCTTG
GCCTGCGCGCTGACTGTCTTCATCAGGTCAGCATTGTTGCCCTCAGGGACGGTCAGATCGAGGTGGTGCAATCGT
CTATGCTAGGGTCTATCCTGTCCAACTTGCTGCTTGTCATGGGCATGTGCTTCCTTTTCGGCGGCATCGTTCACC
GCGGTCAAAACGGCGAAGGCACCGAGCAGCGCTTCTCCTCCGCCGTCGCTCAGACTACCTGCTCCCTCATGACGC
TCTCGTCCGCCTCCCTCGTCATCCCTGCTGCTGTGAGTTTGAGTCGTCCATCGGATCCTTCTCTTATTCAGGAGC
TGACATGCCGACCTCCTCGCAGCTCTATGCCGTCCTTACCCAGAACGGCTCGGATGAGAAGCAAACCAGCATTCT
CATCCTATCGAGAGGCACCGCAATTATCCTCTTGCTGCTTTACGTCCTCTATCTCGTCTTCCAGTTGCGCACCCA
CAGCAACCTGTTCGACCCCGAAACCCCCCCGGAGACGGCCACCGAGGCTATCCAACGCGAGGCTGTGGAGGAGCA
GACGCCGTCGATGAGTGCGCCCGCTGCAGCCGCCGTCCTCGTCGTCGTCACCATCCTCGTCGCCATCTGTGCCGA
TTACCTGGTTGGCAGCATCGATCACATCGTCGCCACCGCCCACATCAGCAAGGCTTTCCTCGGCATGATTCTCAT
TCCTATTGTTGGCAACGCAGCCGAGCACGTCACCGCAGTTGTCGTGGCCCTTCGCGACAAGATGGACCTAGCCAT
GGGCGTCGCTATCGGCTCATCGATACAGATTGCCCTCGGCGCCACGCCTTTCCTCGTCATCGTCGGTTGGATCAT
CGGACAGCCCATGTCGCTGCATTTTGAGACGTGTACGTTGATGTTTCCGCCCTCACTGAAGAAGCCAAGTCTCGT
CGTACTGACCGCTTAATCAGTTCAAACTGTCGCCTTTGCCGTCTCCGTCTTGGTCGTCACCTACACTGTTCAGGA
CGGACGCTCCAACTACCTCGAGGGCGCCATGCTGCTCGCCCTGTACATCATCATTGCCGTCGCCTTTTACGCGAC
GCCCAGCGACGCCATCGACAAATCTTACCGCAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail