Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01255
Gene name
Locationscaffold_01:4506914..4510156
Strand-
Gene length (bp)3242
Transcript length (bp)3120
Coding sequence length (bp)3120
Protein length (aa) 1040

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 3.6E-70 691 1001
PF08699 ArgoL1 Argonaute linker 1 domain 8.9E-10 318 366
PF16488 ArgoL2 Argonaute linker 2 domain 1.3E-08 538 583
PF02170 PAZ PAZ domain 7.5E-07 455 527

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6457 0.6143 0.5012 0.0305 0.0695 0.0023 0.0792 0.054 0.0355 0.0066

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup737
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4073
Ophiocordyceps australis map64 (Brazil) OphauB2|439
Ophiocordyceps camponoti-floridani Ophcf2|01255 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2293
Ophiocordyceps kimflemingae Ophio5|8502
Ophiocordyceps subramaniannii Hirsu2|1954
Ophiocordyceps subramaniannii Hirsu2|978

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01255
MAERGGRGGGRGRGGGDRGGRGGSDRGRGGYDRGRGGYDRGRGGYDRGGYDRGRGGGGFRGDRGGGRGGRGGDRD
PTLNMIFCPEESVPSPDPAVRQLEDRVVRELASAAGLTSQMSQASISGTALQAKSTDLFPYRPAYGTNGQAVVVR
ANYSAVKAKPIVWYKYTMTFMQVGIETADGPAPDNKSGAREVKGQKLYLAAKELLTVLSAANPSLVLATEFKSQL
VSNQKLKLGDDEPVRLKLPLGPDSDKIDLIDAKIHGPAEVPLEDLLRFIATMNDGPSDELFPKYPEAVDALNVIL
GYGPRCKSDTISAVGKSRYFPFGPGQAIVKLHQDFRPLLAARGFFQSVRLGTGRLLLNVNTTHGVFKDSGRVDKL
FEAFGIQPVQSSDHRGKRQLKDFAKSWPKSRVKVDMFLSNGQKFRKSKIIHGLVSQSELSRPSLSNKLKFTNGLE
YPGPKDVQFPLKDASGKQTYISVSDHFKKKYSMNLKNLPLLNLGTAEKPTLYPAEMVEITPGQMVKAKLTMRETT
AMLDEACRTPYSNALSISDDARKTLGLDDSGLAKFGLSVDKSLLTIDARILKVPMVTYLNKQHRAESVATKNGSW
NMKNVQVAKPGAMIERWTFLNILKRNDSPVIGKNTMVDFAKFLIISGIRIKQEPVVDRDGRMTTTWERAMANDGA
IEGFLKWAATNKVQYVFFVITEKDTRGLYPKIKSLADCVYGIHTSICLSKHLTRENNFSYYANVGLKVNLKMGGI
NHRLKEELSLLREGKTMVVGYDVTHPTNMPSGSSKDAPSLVGLVASVDKDCGQWPAYSWEQTSKQEMLSDRLVDA
FKTRLDLWAKHNRNQFPENIVIYRDGVSEGQYAQVLRDELPFIHEACRAKYPATQKPKLSIIVSVKRHQTRFFPC
SKDSMSDSGNVRNGTVVDRGVTQARYWDFYLAAHHALKGTARPAHYTVLLDEVFRSKYKAQAANELQQMTHELCY
LYGRATKAVSICPPAYYADIVCERARVHRPEIFDVSDTESVSTVSTGVASRQVHAALKDSMYYI*
Coding >Ophcf2|01255
ATGGCTGAACGTGGTGGTCGCGGTGGTGGCCGAGGCCGCGGAGGCGGAGACCGTGGTGGTCGCGGTGGTTCCGAC
CGGGGCCGCGGCGGCTATGATCGTGGTCGCGGCGGCTATGATCGTGGTCGCGGTGGTTATGATCGCGGTGGTTAC
GATCGCGGCCGTGGCGGCGGCGGCTTCCGCGGCGATCGAGGAGGCGGCCGTGGCGGCCGTGGCGGGGACCGCGAT
CCCACTCTTAACATGATATTTTGCCCTGAAGAATCCGTTCCCAGTCCAGACCCGGCCGTCAGGCAGCTTGAAGAC
CGCGTTGTCCGCGAGCTCGCCTCCGCAGCCGGCTTGACCTCTCAAATGAGCCAGGCCAGCATCAGCGGAACGGCA
CTTCAGGCTAAGTCGACCGATCTCTTTCCCTATCGTCCCGCCTACGGCACCAACGGCCAAGCTGTGGTCGTCAGG
GCGAACTACTCAGCCGTCAAGGCGAAGCCTATCGTGTGGTATAAATACACCATGACCTTCATGCAGGTGGGCATT
GAGACGGCCGATGGCCCGGCGCCAGACAACAAGTCCGGCGCCAGAGAGGTCAAAGGTCAAAAGCTCTATCTCGCG
GCGAAAGAACTATTGACGGTTCTGAGTGCAGCGAATCCGTCGCTTGTCTTGGCAACAGAGTTCAAGAGCCAGTTG
GTGTCGAATCAGAAACTTAAGCTGGGAGATGATGAGCCGGTTCGGCTCAAGTTACCCTTGGGCCCGGACTCGGAC
AAGATAGACCTCATCGACGCCAAGATACACGGCCCGGCCGAGGTGCCCCTTGAGGACCTCCTGCGCTTCATCGCC
ACCATGAACGATGGCCCTAGCGACGAACTCTTCCCGAAGTATCCGGAGGCCGTTGATGCCCTTAACGTCATCCTC
GGGTACGGCCCGCGCTGCAAGTCAGATACCATCTCTGCCGTGGGCAAGTCCCGTTACTTTCCATTCGGTCCCGGT
CAGGCCATTGTCAAACTCCATCAGGACTTCCGGCCGCTCCTTGCCGCCCGTGGCTTCTTCCAGTCGGTTCGCCTC
GGCACTGGCCGGTTGCTGCTCAACGTCAATACAACCCATGGGGTTTTCAAAGATTCGGGCCGAGTGGACAAGCTC
TTTGAGGCGTTTGGGATTCAGCCAGTCCAGTCTTCGGACCACCGCGGCAAGAGACAGCTTAAGGATTTCGCCAAG
TCCTGGCCCAAGAGTCGTGTCAAGGTCGATATGTTTTTGAGCAACGGCCAGAAATTTCGCAAGTCCAAAATAATA
CACGGCCTTGTCTCGCAGTCGGAGCTGTCGCGCCCATCGTTGAGCAACAAGCTCAAATTCACCAACGGGCTCGAA
TATCCCGGACCGAAGGATGTACAGTTTCCACTGAAGGACGCTTCGGGCAAGCAAACGTACATCTCCGTCTCTGAT
CACTTCAAGAAAAAGTATTCGATGAATCTGAAGAATCTTCCGCTTCTGAACTTGGGCACTGCAGAGAAGCCGACG
CTCTATCCCGCGGAAATGGTCGAGATCACGCCAGGTCAGATGGTGAAGGCAAAATTGACGATGAGGGAGACCACG
GCGATGCTTGACGAGGCGTGCCGCACGCCGTACTCCAATGCCTTGTCAATCAGTGACGATGCCCGCAAGACGCTC
GGTCTCGATGACAGCGGACTTGCCAAGTTCGGCCTCAGCGTCGATAAGAGTCTGCTGACGATCGACGCCCGCATC
CTCAAAGTGCCGATGGTCACTTACCTCAATAAGCAGCATCGCGCCGAATCTGTGGCGACCAAAAACGGAAGCTGG
AATATGAAGAACGTTCAGGTGGCCAAGCCGGGAGCCATGATCGAGCGCTGGACCTTTTTGAATATTCTGAAGCGA
AACGACAGCCCGGTGATCGGGAAAAACACAATGGTCGATTTTGCCAAGTTCCTCATCATCTCTGGCATCCGCATC
AAACAAGAGCCCGTCGTCGACAGGGATGGGAGAATGACGACTACATGGGAAAGGGCAATGGCGAACGATGGCGCT
ATCGAAGGTTTCCTCAAGTGGGCTGCAACCAATAAGGTGCAATATGTCTTCTTCGTGATCACGGAGAAGGACACG
CGAGGTCTCTATCCCAAGATCAAGAGCCTCGCCGACTGCGTCTACGGCATCCACACGAGCATCTGTCTTTCGAAG
CACCTGACAAGGGAGAACAATTTCTCTTACTACGCGAACGTCGGGCTCAAGGTCAACCTCAAGATGGGCGGTATT
AACCACCGCCTCAAGGAAGAATTGAGCTTGCTGAGAGAGGGTAAGACCATGGTAGTCGGATACGACGTGACGCAC
CCGACAAACATGCCCTCGGGCTCAAGCAAGGACGCGCCCAGTCTGGTTGGCCTGGTCGCAAGCGTGGACAAGGAC
TGCGGCCAATGGCCGGCATATTCGTGGGAGCAGACGTCAAAGCAGGAGATGCTCAGCGACCGCCTCGTGGACGCC
TTCAAGACGCGACTGGATCTATGGGCGAAGCACAACAGGAATCAATTCCCGGAAAACATTGTCATCTACCGCGAC
GGCGTCTCCGAGGGTCAGTACGCGCAGGTGCTGCGCGACGAGCTGCCCTTCATCCACGAGGCGTGCCGTGCAAAG
TACCCAGCGACGCAGAAGCCGAAGCTGAGCATCATTGTCTCTGTGAAGCGACATCAGACACGCTTCTTCCCGTGC
AGCAAGGACTCCATGTCGGACTCTGGAAACGTGCGCAACGGGACGGTGGTGGACCGAGGCGTGACGCAGGCGCGC
TATTGGGACTTTTACCTGGCGGCGCATCACGCCCTCAAGGGTACGGCGCGTCCGGCGCATTACACGGTCCTTCTC
GATGAGGTGTTCCGGTCCAAGTACAAGGCTCAGGCTGCCAACGAGCTCCAGCAGATGACACACGAGTTGTGTTAT
CTGTACGGGCGAGCCACCAAGGCCGTGAGCATCTGTCCGCCGGCTTACTATGCGGACATTGTGTGCGAGCGAGCC
CGCGTACACCGGCCCGAGATCTTCGACGTGAGCGACACGGAGAGCGTCTCGACGGTCAGCACCGGCGTGGCGAGT
CGCCAGGTTCATGCGGCGCTTAAAGATAGTATGTACTACATTTAG
Transcript >Ophcf2|01255
ATGGCTGAACGTGGTGGTCGCGGTGGTGGCCGAGGCCGCGGAGGCGGAGACCGTGGTGGTCGCGGTGGTTCCGAC
CGGGGCCGCGGCGGCTATGATCGTGGTCGCGGCGGCTATGATCGTGGTCGCGGTGGTTATGATCGCGGTGGTTAC
GATCGCGGCCGTGGCGGCGGCGGCTTCCGCGGCGATCGAGGAGGCGGCCGTGGCGGCCGTGGCGGGGACCGCGAT
CCCACTCTTAACATGATATTTTGCCCTGAAGAATCCGTTCCCAGTCCAGACCCGGCCGTCAGGCAGCTTGAAGAC
CGCGTTGTCCGCGAGCTCGCCTCCGCAGCCGGCTTGACCTCTCAAATGAGCCAGGCCAGCATCAGCGGAACGGCA
CTTCAGGCTAAGTCGACCGATCTCTTTCCCTATCGTCCCGCCTACGGCACCAACGGCCAAGCTGTGGTCGTCAGG
GCGAACTACTCAGCCGTCAAGGCGAAGCCTATCGTGTGGTATAAATACACCATGACCTTCATGCAGGTGGGCATT
GAGACGGCCGATGGCCCGGCGCCAGACAACAAGTCCGGCGCCAGAGAGGTCAAAGGTCAAAAGCTCTATCTCGCG
GCGAAAGAACTATTGACGGTTCTGAGTGCAGCGAATCCGTCGCTTGTCTTGGCAACAGAGTTCAAGAGCCAGTTG
GTGTCGAATCAGAAACTTAAGCTGGGAGATGATGAGCCGGTTCGGCTCAAGTTACCCTTGGGCCCGGACTCGGAC
AAGATAGACCTCATCGACGCCAAGATACACGGCCCGGCCGAGGTGCCCCTTGAGGACCTCCTGCGCTTCATCGCC
ACCATGAACGATGGCCCTAGCGACGAACTCTTCCCGAAGTATCCGGAGGCCGTTGATGCCCTTAACGTCATCCTC
GGGTACGGCCCGCGCTGCAAGTCAGATACCATCTCTGCCGTGGGCAAGTCCCGTTACTTTCCATTCGGTCCCGGT
CAGGCCATTGTCAAACTCCATCAGGACTTCCGGCCGCTCCTTGCCGCCCGTGGCTTCTTCCAGTCGGTTCGCCTC
GGCACTGGCCGGTTGCTGCTCAACGTCAATACAACCCATGGGGTTTTCAAAGATTCGGGCCGAGTGGACAAGCTC
TTTGAGGCGTTTGGGATTCAGCCAGTCCAGTCTTCGGACCACCGCGGCAAGAGACAGCTTAAGGATTTCGCCAAG
TCCTGGCCCAAGAGTCGTGTCAAGGTCGATATGTTTTTGAGCAACGGCCAGAAATTTCGCAAGTCCAAAATAATA
CACGGCCTTGTCTCGCAGTCGGAGCTGTCGCGCCCATCGTTGAGCAACAAGCTCAAATTCACCAACGGGCTCGAA
TATCCCGGACCGAAGGATGTACAGTTTCCACTGAAGGACGCTTCGGGCAAGCAAACGTACATCTCCGTCTCTGAT
CACTTCAAGAAAAAGTATTCGATGAATCTGAAGAATCTTCCGCTTCTGAACTTGGGCACTGCAGAGAAGCCGACG
CTCTATCCCGCGGAAATGGTCGAGATCACGCCAGGTCAGATGGTGAAGGCAAAATTGACGATGAGGGAGACCACG
GCGATGCTTGACGAGGCGTGCCGCACGCCGTACTCCAATGCCTTGTCAATCAGTGACGATGCCCGCAAGACGCTC
GGTCTCGATGACAGCGGACTTGCCAAGTTCGGCCTCAGCGTCGATAAGAGTCTGCTGACGATCGACGCCCGCATC
CTCAAAGTGCCGATGGTCACTTACCTCAATAAGCAGCATCGCGCCGAATCTGTGGCGACCAAAAACGGAAGCTGG
AATATGAAGAACGTTCAGGTGGCCAAGCCGGGAGCCATGATCGAGCGCTGGACCTTTTTGAATATTCTGAAGCGA
AACGACAGCCCGGTGATCGGGAAAAACACAATGGTCGATTTTGCCAAGTTCCTCATCATCTCTGGCATCCGCATC
AAACAAGAGCCCGTCGTCGACAGGGATGGGAGAATGACGACTACATGGGAAAGGGCAATGGCGAACGATGGCGCT
ATCGAAGGTTTCCTCAAGTGGGCTGCAACCAATAAGGTGCAATATGTCTTCTTCGTGATCACGGAGAAGGACACG
CGAGGTCTCTATCCCAAGATCAAGAGCCTCGCCGACTGCGTCTACGGCATCCACACGAGCATCTGTCTTTCGAAG
CACCTGACAAGGGAGAACAATTTCTCTTACTACGCGAACGTCGGGCTCAAGGTCAACCTCAAGATGGGCGGTATT
AACCACCGCCTCAAGGAAGAATTGAGCTTGCTGAGAGAGGGTAAGACCATGGTAGTCGGATACGACGTGACGCAC
CCGACAAACATGCCCTCGGGCTCAAGCAAGGACGCGCCCAGTCTGGTTGGCCTGGTCGCAAGCGTGGACAAGGAC
TGCGGCCAATGGCCGGCATATTCGTGGGAGCAGACGTCAAAGCAGGAGATGCTCAGCGACCGCCTCGTGGACGCC
TTCAAGACGCGACTGGATCTATGGGCGAAGCACAACAGGAATCAATTCCCGGAAAACATTGTCATCTACCGCGAC
GGCGTCTCCGAGGGTCAGTACGCGCAGGTGCTGCGCGACGAGCTGCCCTTCATCCACGAGGCGTGCCGTGCAAAG
TACCCAGCGACGCAGAAGCCGAAGCTGAGCATCATTGTCTCTGTGAAGCGACATCAGACACGCTTCTTCCCGTGC
AGCAAGGACTCCATGTCGGACTCTGGAAACGTGCGCAACGGGACGGTGGTGGACCGAGGCGTGACGCAGGCGCGC
TATTGGGACTTTTACCTGGCGGCGCATCACGCCCTCAAGGGTACGGCGCGTCCGGCGCATTACACGGTCCTTCTC
GATGAGGTGTTCCGGTCCAAGTACAAGGCTCAGGCTGCCAACGAGCTCCAGCAGATGACACACGAGTTGTGTTAT
CTGTACGGGCGAGCCACCAAGGCCGTGAGCATCTGTCCGCCGGCTTACTATGCGGACATTGTGTGCGAGCGAGCC
CGCGTACACCGGCCCGAGATCTTCGACGTGAGCGACACGGAGAGCGTCTCGACGGTCAGCACCGGCGTGGCGAGT
CGCCAGGTTCATGCGGCGCTTAAAGATAGTATGTACTACATTTAG
Gene >Ophcf2|01255
ATGGCTGAACGTGGTGGTCGCGGTGGTGGCCGAGGCCGCGGAGGCGGAGACCGTGGTGGTCGCGGTGGTTCCGAC
CGGGGCCGCGGCGGCTATGATCGTGGTCGCGGCGGCTATGATCGTGGTCGCGGTGGTTATGATCGCGGTGGTTAC
GATCGCGGCCGTGGCGGCGGCGGCTTCCGCGGCGATCGAGGAGGCGGCCGTGGCGGCCGTGGCGGGGACCGCGAT
CCCACTCTTAACATGATATTTTGGTAATACTTCCCTTCCCATCATAATCCGAATCTGACCGCTGACGAGACGTGA
TGACAGCCCTGAAGAATCCGTTCCCAGTCCAGACCCGGCCGTCAGGCAGCTTGAAGACCGCGTTGTCCGCGAGCT
CGCCTCCGCAGCCGGCTTGACCTCTCAAATGAGCCAGGCCAGCATCAGCGGAACGGCACTTCAGGCTAAGTCGAC
CGATCTCTTTCCCTATCGTCCCGCCTACGGCACCAACGGCCAAGCTGTGGTCGTCAGGGCGAACTACTCAGCCGT
CAAGGCGAAGCCTATCGTGTGGTATAAATACACCATGACCTTCATGCAGGTGGGCATTGAGACGGCCGATGGCCC
GGCGCCAGACAACAAGTCCGGCGCCAGAGAGGTCAAAGGTCAAAAGCTCTATCTCGCGGCGAAAGAACTATTGAC
GGTTCTGAGTGCAGCGAATCCGTCGCTTGTCTTGGCAACAGAGTTCAAGAGCCAGTTGGTGTCGAATCAGAAACT
TAAGCTGGGAGATGATGAGCCGGTTCGGCTCAAGTTACCCTTGGGCCCGGACTCGGACAAGATAGACCTCATCGA
CGCCAAGATACACGGCCCGGCCGAGGTGCCCCTTGAGGACCTCCTGCGCTTCATCGCCACCATGAACGATGGCCC
TAGCGACGAACTCTTCCCGAAGTATCCGGAGGCCGTTGATGCCCTTAACGTCATCCTCGGGTACGGCCCGCGCTG
CAAGTCAGATACCATCTCTGCCGTGGGCAAGTCCCGTTACTTTCCATTCGGTCCCGGTCAGGCCATTGTCAAACT
CCATCAGGACTTCCGGCCGCTCCTTGCCGCCCGTGGCTTCTTCCAGTCGGTTCGCCTCGGCACTGGCCGGTTGCT
GCTCAACGTCAATACAACCCATGGGGTTTTCAAAGATTCGGGCCGAGTGGACAAGCTCTTTGAGGCGTTTGGGAT
TCAGCCAGTCCAGTCTTCGGACCACCGCGGCAAGAGACAGCTTAAGGATTTCGCCAAGTCCTGGCCCAAGAGTCG
TGTCAAGGTCGATATGTTTTTGAGCAACGGCCAGAAATTTCGCAAGTCCAAAATAATACACGGCCTTGTCTCGCA
GTCGGAGCTGTCGCGCCCATCGTTGAGCAACAAGCTCAAATTCACCAACGGGCTCGAATATCCCGGACCGAAGGA
TGTACAGTTTCCACTGAAGGACGCTTCGGGCAAGCAAACGTACATCTCCGTCTCTGATCACTTCAAGAAAAGTGA
GTTTGCCAATATTGAATCGCGGAAATGTAATACGGCACTAACGGACAACTCCCCGTGCAGAGTATTCGATGAATC
TGAAGAATCTTCCGCTTCTGAACTTGGGCACTGCAGAGAAGCCGACGCTCTATCCCGCGGAAATGGTCGAGATCA
CGCCAGGTCAGATGGTGAAGGCAAAATTGACGATGAGGGAGACCACGGCGATGCTTGACGAGGCGTGCCGCACGC
CGTACTCCAATGCCTTGTCAATCAGTGACGATGCCCGCAAGACGCTCGGTCTCGATGACAGCGGACTTGCCAAGT
TCGGCCTCAGCGTCGATAAGAGTCTGCTGACGATCGACGCCCGCATCCTCAAAGTGCCGATGGTCACTTACCTCA
ATAAGCAGCATCGCGCCGAATCTGTGGCGACCAAAAACGGAAGCTGGAATATGAAGAACGTTCAGGTGGCCAAGC
CGGGAGCCATGATCGAGCGCTGGACCTTTTTGAATATTCTGAAGCGAAACGACAGCCCGGTGATCGGGAAAAACA
CAATGGTCGATTTTGCCAAGTTCCTCATCATCTCTGGCATCCGCATCAAACAAGAGCCCGTCGTCGACAGGGATG
GGAGAATGACGACTACATGGGAAAGGGCAATGGCGAACGATGGCGCTATCGAAGGTTTCCTCAAGTGGGCTGCAA
CCAATAAGGTGCAATATGTCTTCTTCGTGATCACGGAGAAGGACACGCGAGGTCTCTATCCCAAGATCAAGAGCC
TCGCCGACTGCGTCTACGGCATCCACACGAGCATCTGTCTTTCGAAGCACCTGACAAGGGAGAACAATTTCTCTT
ACTACGCGAACGTCGGGCTCAAGGTCAACCTCAAGATGGGCGGTATTAACCACCGCCTCAAGGAAGAATTGAGCT
TGCTGAGAGAGGGTAAGACCATGGTAGTCGGATACGACGTGACGCACCCGACAAACATGCCCTCGGGCTCAAGCA
AGGACGCGCCCAGTCTGGTTGGCCTGGTCGCAAGCGTGGACAAGGACTGCGGCCAATGGCCGGCATATTCGTGGG
AGCAGACGTCAAAGCAGGAGATGCTCAGCGACCGCCTCGTGGACGCCTTCAAGACGCGACTGGATCTATGGGCGA
AGCACAACAGGAATCAATTCCCGGAAAACATTGTCATCTACCGCGACGGCGTCTCCGAGGGTCAGTACGCGCAGG
TGCTGCGCGACGAGCTGCCCTTCATCCACGAGGCGTGCCGTGCAAAGTACCCAGCGACGCAGAAGCCGAAGCTGA
GCATCATTGTCTCTGTGAAGCGACATCAGACACGCTTCTTCCCGTGCAGCAAGGACTCCATGTCGGACTCTGGAA
ACGTGCGCAACGGGACGGTGGTGGACCGAGGCGTGACGCAGGCGCGCTATTGGGACTTTTACCTGGCGGCGCATC
ACGCCCTCAAGGGTACGGCGCGTCCGGCGCATTACACGGTCCTTCTCGATGAGGTGTTCCGGTCCAAGTACAAGG
CTCAGGCTGCCAACGAGCTCCAGCAGATGACACACGAGTTGTGTTATCTGTACGGGCGAGCCACCAAGGCCGTGA
GCATCTGTCCGCCGGCTTACTATGCGGACATTGTGTGCGAGCGAGCCCGCGTACACCGGCCCGAGATCTTCGACG
TGAGCGACACGGAGAGCGTCTCGACGGTCAGCACCGGCGTGGCGAGTCGCCAGGTTCATGCGGCGCTTAAAGATA
GTATGTACTACATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail