Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01253
Gene name
Locationscaffold_01:4502488..4505507
Strand+
Gene length (bp)3019
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.2E-37 90 494
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.0E-09 105 504

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 86 108 22
3 121 143 22
4 153 175 22
5 180 199 19
6 209 231 22
7 240 262 22
8 282 304 22
9 311 333 22
10 353 375 22
11 387 409 22
12 413 435 22
13 448 470 22
14 475 497 22
15 556 575 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01253
MRVCAAIVAVVLSIGSGVLAAPANAADSPLGEAAKKAQGQTSAQPQRRSNAALTKERDSHPRGTQDTTTEGREQA
SYPSGPQLALLILALCLSVFLVALDQTIIAPALGAITAQFQSVKDIGWYGSSYLLTTTALQPVYGAVYRQFDVKA
VYLVAVFVFEVGSLVTAVAPTSTVFIVGRAVSGVGTAGIFSGSIVILSLSMPLGRRPLVFGLIGGMWGIASVAGP
LLGGAFTQNVTWRWCFYINLPIGGLAMVIVFCVVSVHRNSVDSPPTPFAHRLRQLDLSGVALFVPAIVCLLLALQ
WGGAEYEWRDSRIIGLLVGFGLLTVVFAAVQLYKGDGGTLPPRLFADRNVLCAMLFAFFFGAGFFPLVFYLSLYF
QAIQGDTAVQAGIKILPLLLATVFASIGAGIIVSTFGYYNPVIIPCTLLFIVGSAMLTTLDVDNTPLRKWFGYQV
LTGIGIGPGFQTGVLTVQTVLPQDMVPVGVACVQFFQALGGAVFVAVAQTLFQNGIIDGVARLGFDGRAFINSGA
NEIEQVLARLDRLGLRKPVLEAYMTGLRHTFFISIAAAACAFFCVLGLEWKSVKKSPYGRARPNEAPSIPP*
Coding >Ophcf2|01253
ATGAGAGTGTGCGCCGCCATCGTGGCCGTCGTCCTATCCATCGGCAGCGGGGTGCTCGCAGCTCCGGCAAACGCG
GCCGACTCACCGCTCGGCGAGGCGGCCAAGAAGGCTCAGGGGCAGACATCGGCGCAGCCGCAGCGGAGGAGTAAC
GCGGCCTTGACCAAGGAGCGAGATAGCCATCCTCGAGGCACTCAAGACACAACCACAGAAGGAAGAGAACAAGCC
TCCTACCCCTCAGGCCCCCAGCTCGCGCTCCTAATCCTAGCCCTCTGCCTGTCCGTCTTCCTCGTCGCGCTGGAC
CAGACCATCATCGCGCCAGCGCTGGGAGCCATTACGGCGCAGTTTCAGAGCGTCAAGGACATTGGATGGTATGGC
TCTTCGTATTTACTTACCACGACGGCGCTTCAGCCTGTTTATGGGGCTGTCTATCGTCAGTTTGACGTCAAGGCT
GTTTATCTTGTCGCCGTCTTCGTCTTTGAGGTTGGCAGTTTGGTGACGGCTGTTGCTCCGACTTCTACCGTCTTC
ATCGTCGGACGGGCCGTATCTGGCGTTGGCACAGCCGGCATCTTCTCCGGCTCCATCGTCATCCTCTCCCTCTCC
ATGCCTCTCGGCCGCCGTCCGCTCGTCTTCGGCCTCATCGGCGGAATGTGGGGCATCGCCTCCGTCGCCGGCCCC
CTCCTCGGCGGCGCCTTTACACAAAACGTTACCTGGCGCTGGTGTTTCTACATCAACCTCCCGATAGGCGGTCTA
GCCATGGTCATCGTCTTCTGCGTCGTCTCCGTCCACCGCAACAGCGTCGACTCCCCGCCGACGCCCTTCGCCCAC
CGCCTCCGTCAGCTTGATCTCAGCGGCGTCGCCCTCTTCGTGCCCGCCATCGTCTGCCTGTTGCTCGCGCTGCAG
TGGGGGGGCGCAGAGTACGAATGGCGGGACTCACGTATCATCGGCCTCCTTGTTGGCTTCGGCCTCTTGACCGTT
GTCTTTGCAGCTGTTCAGCTGTACAAGGGCGATGGGGGCACGTTGCCGCCCCGGTTGTTTGCGGATCGAAACGTG
CTGTGCGCCATGCTGTTTGCTTTCTTCTTCGGCGCCGGCTTCTTCCCGCTGGTATTCTATCTCTCCCTCTACTTC
CAGGCCATTCAGGGCGACACCGCCGTTCAAGCCGGCATCAAGATCCTCCCCCTCCTCCTCGCCACCGTCTTCGCC
TCCATCGGCGCCGGCATCATCGTTTCAACCTTTGGCTACTACAACCCCGTCATCATCCCCTGCACCCTCCTCTTC
ATCGTAGGCTCCGCCATGCTGACGACTCTCGACGTCGACAACACCCCCCTCCGGAAATGGTTCGGCTACCAGGTC
CTAACGGGCATAGGCATCGGCCCGGGCTTCCAGACGGGCGTCCTGACGGTGCAAACCGTGCTGCCTCAGGACATG
GTACCCGTAGGCGTCGCCTGCGTCCAGTTCTTCCAGGCTCTCGGGGGCGCCGTCTTCGTCGCCGTCGCCCAGACG
CTCTTCCAGAACGGCATCATCGACGGCGTTGCCCGCCTCGGCTTCGACGGCCGGGCCTTTATCAACAGCGGCGCG
AACGAGATCGAGCAGGTCCTCGCCCGTCTCGACCGTCTCGGCCTCCGGAAGCCCGTCCTCGAAGCCTATATGACG
GGCCTGCGCCATACATTCTTCATCTCCATTGCCGCCGCCGCCTGTGCCTTCTTCTGCGTCCTCGGTCTCGAGTGG
AAGTCGGTCAAGAAGAGTCCGTATGGCCGGGCGAGACCCAACGAGGCACCGTCAATACCGCCGTAG
Transcript >Ophcf2|01253
ATGAGAGTGTGCGCCGCCATCGTGGCCGTCGTCCTATCCATCGGCAGCGGGGTGCTCGCAGCTCCGGCAAACGCG
GCCGACTCACCGCTCGGCGAGGCGGCCAAGAAGGCTCAGGGGCAGACATCGGCGCAGCCGCAGCGGAGGAGTAAC
GCGGCCTTGACCAAGGAGCGAGATAGCCATCCTCGAGGCACTCAAGACACAACCACAGAAGGAAGAGAACAAGCC
TCCTACCCCTCAGGCCCCCAGCTCGCGCTCCTAATCCTAGCCCTCTGCCTGTCCGTCTTCCTCGTCGCGCTGGAC
CAGACCATCATCGCGCCAGCGCTGGGAGCCATTACGGCGCAGTTTCAGAGCGTCAAGGACATTGGATGGTATGGC
TCTTCGTATTTACTTACCACGACGGCGCTTCAGCCTGTTTATGGGGCTGTCTATCGTCAGTTTGACGTCAAGGCT
GTTTATCTTGTCGCCGTCTTCGTCTTTGAGGTTGGCAGTTTGGTGACGGCTGTTGCTCCGACTTCTACCGTCTTC
ATCGTCGGACGGGCCGTATCTGGCGTTGGCACAGCCGGCATCTTCTCCGGCTCCATCGTCATCCTCTCCCTCTCC
ATGCCTCTCGGCCGCCGTCCGCTCGTCTTCGGCCTCATCGGCGGAATGTGGGGCATCGCCTCCGTCGCCGGCCCC
CTCCTCGGCGGCGCCTTTACACAAAACGTTACCTGGCGCTGGTGTTTCTACATCAACCTCCCGATAGGCGGTCTA
GCCATGGTCATCGTCTTCTGCGTCGTCTCCGTCCACCGCAACAGCGTCGACTCCCCGCCGACGCCCTTCGCCCAC
CGCCTCCGTCAGCTTGATCTCAGCGGCGTCGCCCTCTTCGTGCCCGCCATCGTCTGCCTGTTGCTCGCGCTGCAG
TGGGGGGGCGCAGAGTACGAATGGCGGGACTCACGTATCATCGGCCTCCTTGTTGGCTTCGGCCTCTTGACCGTT
GTCTTTGCAGCTGTTCAGCTGTACAAGGGCGATGGGGGCACGTTGCCGCCCCGGTTGTTTGCGGATCGAAACGTG
CTGTGCGCCATGCTGTTTGCTTTCTTCTTCGGCGCCGGCTTCTTCCCGCTGGTATTCTATCTCTCCCTCTACTTC
CAGGCCATTCAGGGCGACACCGCCGTTCAAGCCGGCATCAAGATCCTCCCCCTCCTCCTCGCCACCGTCTTCGCC
TCCATCGGCGCCGGCATCATCGTTTCAACCTTTGGCTACTACAACCCCGTCATCATCCCCTGCACCCTCCTCTTC
ATCGTAGGCTCCGCCATGCTGACGACTCTCGACGTCGACAACACCCCCCTCCGGAAATGGTTCGGCTACCAGGTC
CTAACGGGCATAGGCATCGGCCCGGGCTTCCAGACGGGCGTCCTGACGGTGCAAACCGTGCTGCCTCAGGACATG
GTACCCGTAGGCGTCGCCTGCGTCCAGTTCTTCCAGGCTCTCGGGGGCGCCGTCTTCGTCGCCGTCGCCCAGACG
CTCTTCCAGAACGGCATCATCGACGGCGTTGCCCGCCTCGGCTTCGACGGCCGGGCCTTTATCAACAGCGGCGCG
AACGAGATCGAGCAGGTCCTCGCCCGTCTCGACCGTCTCGGCCTCCGGAAGCCCGTCCTCGAAGCCTATATGACG
GGCCTGCGCCATACATTCTTCATCTCCATTGCCGCCGCCGCCTGTGCCTTCTTCTGCGTCCTCGGTCTCGAGTGG
AAGTCGGTCAAGAAGAGTCCGTATGGCCGGGCGAGACCCAACGAGGCACCGTCAATACCGCCGTAG
Gene >Ophcf2|01253
ATGAGAGTGTGCGCCGCCATCGTGGCCGTCGTCCTATCCATCGGCAGCGGGGTGCTCGCAGCTCCGGCAAACGCG
GCCGACTCACCGCTCGGCGAGGCGGCCAAGAAGGCTCAGGGGCAGACATCGGCGCAGCCGCAGCGGAGGAGTAAC
GCGGCCTTGACCAAGGAGGTGGTGCACCACAAGCCGGCCGAGGGCTGATAAAGTAAGGGTGGGGGGGTGTCAGAG
GGAGGGAGGGAGGAGTAAGGGAGGGTGCGATTTCGTGGGTGACAGTGACTTGGATGGGGAGCGAGATTTTGGGGT
GTTTGTGTGTGTAGAACAAGTTGATGGCTTGTGAACAATGAAGGAGGTCAAAGTTGACGATGGCGGTGAGGATAC
GAATAGAAGCTGTGATGTCGGGTGAAAGTTAGCCCGACTCGACTCGGACGTGATCCGCTATACTGTATGTACGAA
TAGACTGTAGACTGTAGTACATGTGTATTTCCTTTTCAAGGGAAAAAGTGGCTCCGCCCTCCTCTCCTCTCCTCT
CCTCTCCTCTCCTCTCCCTAGGAGGTCCTCCCCGCGTCTCCACATACATACATCCGCAAGAACCTCTCTCAACTC
GACGCCCTCCTGAAGCAGGGTCCGGCGGAAGCGAGCCTTATCACTGATCAGGAAGAGGAGGACGAGCAGACAACA
GCCGTGAATACATACGAGAGATCGGATTCGTATCCTCAGCCCGTCTGATCCACCCTCTTCCCCTCATCATGGTCT
CCGTGCTGGGACTAGGGATCACGAGATGAGCTCGGCAGATATCACGCTAACTTCAACGTTGGTTGGGCACATCAT
ACATGGCTGCCTTACCCTACCTACTGTGGTATGTATGTAATATGTATGTACGTATGTATGTATGTATGAGAAAGC
TCATGACCGCGCACCGACTCCCGCCGAGAAGCGAATGTCAGACGAAGCCCCATAGCAACTCCTCAAGAATACATG
CATACATACATACATAAACACGGTATAAGAGAAAAAGGCCAAGGCTTTCTTTCCCACGCCCCCCCCCTCCCCGGA
AAAAAAAAACCGCACATCAAACCTCCACTTCAATGACGAAGGAATCGCCAACCAAAGATGCCGAAGCGCAGCGAG
ATAGCCATCCTCGAGGCACTCAAGACACAACCACAGAAGGAAGAGAACAAGCCTCCTACCCCTCAGGCCCCCAGC
TCGCGCTCCTAATCCTAGCCCTCTGCCTGTCCGTCTTCCTCGTCGCGCTGGACCAGACCATCATCGCGCCAGCGC
TGGGAGCCATTACGGCGCAGTTTCAGAGCGTCAAGGACATTGTTCGTCCCTCCTTTCCCCCCTCCTTTCCCCCCC
CCCTTCCCCCCATTCGGACTGACTTGTGAAAGCTGATGGTGGGAAAAAGGGATGGTATGGCTCTTCGTATTTACT
TACCACGACGGCGCTTCAGCCTGTTTATGGGGCTGTCTATCGTCAGTTTGACGTCAAGGCTGTTTATCTTGTCGC
CGTCTTCGTCTTTGAGGTTGGCAGTTTGGTGACGGCTGTTGCTCCGACTTCTACCGTCTTCATCGTCGGACGGGC
CGTATCTGGCGTGAGGACCTTTTCACCTTTCCCTCTCCCTTTCTATTCATCCGCTGATACCGTCCTCAAGGTTGG
CACAGCCGGCATCTTCTCCGGCTCCATCGTCATCCTCTCCCTCTCCAGTAAATCCCTCCCACAGAAGTCCAACAA
GGCAAAGACACCTTCTTCCAACTAACAAGGCAAAAGTGCCTCTCGGCCGCCGTCCGCTCGTCTTCGGCCTCATCG
GCGGAATGTGGGGCATCGCCTCCGTCGCCGGCCCCCTCCTCGGCGGCGCCTTTACACAAAACGTTACCTGGCGCT
GGTGTTTCTACATCAACCTCCCGATAGGCGGTCTAGCCATGGTCATCGTCTTCTGCGTCGTCTCCGTCCACCGCA
ACAGCGTCGACTCCCCGCCGACGCCCTTCGCCCACCGCCTCCGTCAGCTTGATCTCAGCGGCGTCGCCCTCTTCG
TGCCCGCCATCGTCTGCCTGTTGCTCGCGCTGCAGTGGGGGGGCGCAGAGTACGAATGGCGGGACTCACGTATCA
TCGGCCTCCTTGTTGGCTTCGGCCTCTTGACCGTTGTCTTTGCAGCTGTTCAGCTGTACAAGGGCGATGGGGGCA
CGTTGCCGCCCCGGTTGTTTGCGGATCGAAACGTGCTGTGCGCCATGCTGTTTGCTTTCTTCTTCGGCGCCGGCT
TCTTCCCGCTGGTATTCTATCTCTGTGAGTCCGAGACCCTTTTCCATACCTGTACACACGACGCAAAACCTATCA
ATCTGATGATGGAAAAGCCCTCTACTTCCAGGCCATTCAGGGCGACACCGCCGTTCAAGCCGGCATCAAGATCCT
CCCCCTCCTCCTCGCCACCGTCTTCGCCTCCATCGGCGCCGGCATCATCGTTTCAACCTTTGGCTACTACAACCC
CGTCATCATCCCCTGCACCCTCCTCTTCATCGTAGGCTCCGCCATGCTGACGACTCTCGACGTCGACAACACCCC
CCTCCGGAAATGGTTCGGCTACCAGGTCCTAACGGGCATAGGCATCGGCCCGGGCTTCCAGACGGGCGTCCTGAC
GGTGCAAACCGTGCTGCCTCAGGACATGGTACCCGTAGGCGTCGCCTGCGTCCAGTTCTTCCAGGCTCTCGGGGG
CGCCGTCTTCGTCGCCGTCGCCCAGACGCTCTTCCAGAACGGCATCATCGACGGCGTTGCCCGCCTCGGCTTCGA
CGGCCGGGCCTTTATCAACAGCGGCGCGAACGAGATCGAGCAGGTCCTCGCCCGTCTCGACCGTCTCGGCCTCCG
GAAGCCCGTCCTCGAAGCCTATATGACGGGCCTGCGCCATACATTCTTCATCTCCATTGCCGCCGCCGCCTGTGC
CTTCTTCTGCGTCCTCGGTCTCGAGTGGAAGTCGGTCAAGAAGAGTCCGTATGGCCGGGCGAGACCCAACGAGGC
ACCGTCAATACCGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail